KEGG   Pantoea sp. At-9b: Pat9b_3717Help
Entry
Pat9b_3717        CDS       T01386                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00564  Glycerophospholipid metabolism
pao01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pao00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Pat9b_3717
Enzymes [BR:pao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Pat9b_3717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 NAD_binding_8 3HCDH_N FAD_oxidored GIDA
Motif
Other DBs
NCBI-ProteinID: ADU71007
UniProt: E6WH19
LinkDB All DBs
Position
4050725..4052284
Genome map
AA seq 519 aa AA seqDB search
MLENEHLGTIPNIGGDDVETKDLIVIGGGINGAGIAVDAAGRGLSVLMLEARDLACATSS
ASSKLIHGGLRYLEHYEFRLVGEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRM
GLFMYDHLGKRTSLPGSKSLRFGADSALKSEITRGFEYSDCWVDDARMVVLNAQEVVKQG
GEVRTRTRVTRAWREAGLWMVEAEDIDTGKTYTWRAKGLVNAAGPWVKQFFDDGLKLKSP
YGIRLIKGSHIVVPRVHREKQAYILQNEDHRIVFVIPWMDEFSIIGTTDVEYKGDPKEVK
IDDSEINYLLKVYNGHFKKQLTQEDIVWTYSGVRPLCDDESDSPQAITRDYTLDVHDDHG
QAPLLSVFGGKLTTYRKLAEHALEKLAKYYPNAGPAWTKTAVLPGGNIAGSREDYAASLR
RRYPFISEGMARHYARTFGSNTEVLLAGAQSLADLGENFGHEFYEAELRYLVKHEWVYEL
DDAIWRRTKQGMWLSEAEQARISEWLATHRQKPTLSLAS
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaaaacgaacatttaggaacgattccgaacatcggaggagatgacgtggaaacc
aaagacctgatcgttatcggcggcggcatcaacggtgccggcattgcagtggacgctgca
ggacgcgggctgtcggtgctgatgctggaggcgcgggatttggcctgtgcaacctcctct
gccagttcaaaactgatccacggtggcctgcgctacctggaacactacgaatttcgcctg
gttggcgaagctctggcggaacgtgaagtgctgctgaaaatggcaccgcacattgctttc
ccaatgcgcttccgtctgccgcaccgcccgcacttacgcccggcgtggatgatccgcatg
ggcctgtttatgtatgaccatcttggcaaacgtaccagcctgccgggcagtaagagcctg
cgttttggcgcagattcggcacttaagtctgaaatcacgcgcggattcgaatattccgac
tgctgggtggacgatgcgcgcatggtggtgctcaatgcccaggaagtggtgaaacagggg
ggtgaagtacgcacccgcacccgcgtaacccgcgcctggcgtgaagctggcctgtggatg
gtggaagctgaagatattgataccggcaaaacctatacctggcgtgccaaagggctggtg
aatgcggccggtccgtgggtgaaacagttctttgacgacggcctgaagttgaaatcgccg
tatggcatccgtctgatcaaaggtagccacatcgtggtgccacgcgtgcatcgtgaaaaa
caggcctacattctgcaaaacgaagatcaccgcatcgtgtttgtcattccgtggatggat
gagttctcgatcatcggcaccacagacgtcgagtacaaaggcgatccgaaagaagtgaag
atcgacgacagcgaaatcaactatttgctgaaggtgtacaacggccacttcaaaaaacag
ctgacgcaggaagatatcgtctggacctactcgggtgtgcgcccgctgtgtgacgacgag
tccgattcaccgcaggccatcactcgcgattacacgctggatgtccatgacgatcacggc
caggccccgctgctgtccgtctttggcggcaaactgacgacctaccgtaaactggcagaa
cacgcgctggaaaaactggcgaagtattacccgaacgctggcccggcctggactaaaacg
gcggtgctgccgggaggcaatatcgccggttcgcgcgaagattacgccgccagtctgcgt
cgccgttatccgtttatcagcgaaggtatggcgcgtcattatgcccgcacctttggtagc
aacaccgaagtgttgctggcaggcgcgcagagtctggcagatctcggtgagaacttcggc
catgagttttatgaagccgaactgcgttacctggtgaaacacgaatgggtgtatgaactg
gatgatgctatctggcgtcgtaccaagcagggcatgtggctgagtgaagccgagcaggcg
cgcatcagcgaatggctggccactcaccgccagaaaccgacactgtcgctggcatcgtaa

DBGET integrated database retrieval system