KEGG   Pantoea sp. At-9b: Pat9b_5003Help
Entry
Pat9b_5003        CDS       T01386                                 

Definition
(GenBank) Xylose isomerase domain protein TIM barrel
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00040  Pentose and glucuronate interconversions
pao00051  Fructose and mannose metabolism
pao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Pat9b_5003
   00051 Fructose and mannose metabolism
    Pat9b_5003
Enzymes [BR:pao01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Pat9b_5003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ADU72299
UniProt: E6WLL4
LinkDB All DBs
Position
pPAT9B02:complement(282205..283197)
Genome map
AA seq 330 aa AA seqDB search
MSTWNYPKFGAGLWHFANYVDRYAVDGYGPALSTLEQIRIAGTVEDLSYVDVPYPFTEGV
SVSDVKQALAAAGLKAIGVTPEIYLRRFSRGAFTNPDPVLRKQAFDLMHEAASVVRELGA
NYVKVWPGQDGWDYPFQVDHKNLWRLAVDGMRELASANPDVKFAIEYKPREPRVKMTWDS
AARTLLGIEEMGLDNVGILLDFGHALFAGESPAGSAQLIIDHDRLFGMDVNDNLRGWDDD
LVVGTVHMTEIFEFFYVLKINNWEGVWQLDQFPFREDNVEAANLSIHFLKHVYRALDKLD
IAGLQAAQAEQNPLLAQRIIQNALLTVIEE
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgagtacctggaactacccaaaattcggcgcgggcttgtggcacttcgcaaactatgtt
gaccgttatgcagtcgatggttatggcccggccctgagcacgctggagcaaatccgcatc
gctggcaccgtcgaagacctttcatatgttgacgttccctatcccttcactgagggagtc
agcgtcagtgatgtcaaacaggcgttggctgcggcgggtttgaaagccatcggtgttacc
ccggagatctacttacgtcgtttttctcggggagcgtttactaacccggacccggtacta
cgcaagcaggcatttgatctgatgcatgaagcagccagcgtggtgcgtgagttgggggct
aactatgtcaaggtatggccaggtcaggatggttgggattatccattccaagtcgaccac
aaaaatctctggcggctggcggttgatggcatgcgcgaacttgccagcgccaatccggac
gtaaaatttgccatagagtacaaaccccgcgagccacgggtcaaaatgacatgggattcc
gcagcgaggacgctattgggtattgaggaaatggggctggataatgtcggtattctgctg
gactttgggcatgcattatttgccggcgagtcacctgctggttccgcgcagctgattatc
gatcatgatcgcttgttcggcatggatgtaaacgacaacctgcgcggctgggatgatgac
ctggtggtgggaacggtacatatgacggagatcttcgagttcttttacgtactgaagatc
aataactgggagggagtctggcaattggatcagttcccgttccgtgaggataatgtggaa
gcggctaacctgtcgattcacttcctgaagcatgtgtatcgtgcgttggataagctggat
attgcaggattgcaggctgcgcaagcggaacagaacccgttgctggcgcagaggattatt
cagaatgcgttgctgacggtgattgaggagtga

DBGET integrated database retrieval system