KEGG   Pseudomonas aeruginosa PA7: PSPA7_0987Help
Entry
PSPA7_0987        CDS       T00569                                 

Definition
(GenBank) phosphodiesterase
Organism
pap  Pseudomonas aeruginosa PA7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3391 HD_5 HD HDOD
Motif
Other DBs
NCBI-ProteinID: ABR85171
UniProt: A6UZY8
LinkDB All DBs
Position
complement(990128..991369)
Genome map
AA seq 413 aa AA seqDB search
MLKRIPVTQLRPGMFIQSLCGSWLDHPFWKRGSFLLDNQADLQRLRESAVKEVWIDVGKG
LDLPTEAAAAAAVLPVTMPAAPAPARVALEEEIRQAALLCGKAKRAVVSMFRDARMGQAI
DTAHAAALVDDISASVLRHPNALVSLVRLKTSDEYTYMHSVAVCALMIALARQLDLAEPL
VREAGLAGLLHDIGKMAVPEPILSKPGKLTEQEFGLVRRHPQNGARMLLDCRQVSALVVD
VCLHHHERVDGTGYPFGLAEEQISLLARMGAVCDVYDALTSDRPYKKGWNAAEAIRRMAE
WNGHFDPQVFRAFVKAVGIYPVGVLVRLESGRLGVVLEQHGRSLLTPRVRVFFSARSKVP
IPQQVVDLGQAGQTDRIVGFEPAEAWNFRNLDELWTGLPGSGGSYFDTGTGKP
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtgctgaaacgcattccggtcacccagcttcgccccggcatgttcatccagagcctgtgc
ggctcctggctggaccatccgttctggaaaagaggcagcttcctgctcgataaccaggcc
gacctgcaacgcctgcgcgaaagcgcggtgaaagaggtctggatcgatgtcggcaagggc
ctcgacctgcccaccgaagccgccgcggcggcggccgtgctgccggtgaccatgccggcc
gcgccagcgccggcgcgggtcgccctggaggaagaaatccgccaggccgccctgctctgt
ggcaaggccaagcgcgcggtggtcagcatgttccgcgacgcgcgcatgggccaggccatc
gacaccgcgcatgccgccgcgctggtggacgacatctccgcctcggtgctgcgccacccc
aacgccctggtcagcctggtgcggctgaagacttcggacgagtacacctacatgcactcg
gtggcggtctgcgccctcatgatcgccctcgcccgccagctcgacctggccgagccgctg
gtgcgcgaagcggggctcgccgggttgctccacgacatcggcaagatggcggtgccggaa
ccgatcctgagcaaacccggcaagctcaccgaacaggagttcggcctggtccgccggcat
ccgcagaacggcgcgcggatgctgctcgattgccgccaggtcagcgccctggtggtggat
gtctgcctgcaccaccatgaacgcgtcgacggcaccggctaccccttcggcctggccgaa
gagcagatcagcctgctggcgcgaatgggcgcggtctgcgacgtctacgacgcgctcacc
tccgaccgcccctacaagaagggctggaacgccgccgaggcgatccggcgcatggccgaa
tggaacgggcacttcgacccgcaggtgttccgcgccttcgtcaaggcggtgggcatctac
ccggtcggcgtactggtccggctggaaagcgggcgcctcggcgtggtcctcgaacaacac
ggtcgctcgctgctgacgccacgggtcagggtattcttctcggcccgctcgaaggtgccg
atcccacaacaggtggtggacctcggtcaggccgggcagaccgaccggatcgtcggtttc
gagccggcggaggcgtggaacttccgcaatctcgatgagttgtggacggggctgcccggc
agcggcggatcgtatttcgacacgggaacggggaaaccgtag

DBGET integrated database retrieval system