KEGG   Pseudomonas aeruginosa PA7: PSPA7_0999Help
Entry
PSPA7_0999        CDS       T00569                                 

Definition
(GenBank) putative short-chain dehydrogenase
Organism
pap  Pseudomonas aeruginosa PA7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase KR RmlD_sub_bind GDP_Man_Dehyd DFP
Motif
Other DBs
NCBI-ProteinID: ABR82275
UniProt: A6V000
LinkDB All DBs
Structure
PDB: 

Position
complement(1001292..1002017)
Genome map
AA seq 241 aa AA seqDB search
MVFQKDLYAGQQVLVTGGSSGIGAAIAMQFAELGAEVVALGLDADGVHAPRHPRIRREEL
DITDSQRLQRLFEELPRLDVLVNNAGISRDREEYDLATFERVLRLNLSAAMLASQLARPL
LAQRGGSILNIASMYSTFGSADRPAYSASKGAIVQLTRSLACEYAGQRIRVNAIAPGWID
TPLGAGLKADAEATRRIMQRTPLARWGAAAEVASAAAFLCGPGASFVTGAVLAVDGGYLC
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggttttccagaaagatctctacgccggccagcaggtgctggtcaccggcggcagctcc
ggcatcggcgcggccatcgccatgcagttcgccgaactcggcgccgaagtcgtcgccctc
ggcctggatgccgacggcgtgcacgccccgcgccacccgcggattcgccgggaagaactg
gacatcaccgacagccagcgcctgcaacggctgttcgaagagctaccgcgcctggatgtg
ctggtgaacaacgccggcatcagccgcgaccgcgaggaatacgacctggctaccttcgaa
cgggtgctgcgcctcaacctgagcgccgccatgctcgccagccagctggcccggccgctg
cttgcgcagcgcggtggcagcatcctcaacatcgcctcgatgtacagcaccttcggctcc
gccgaccgcccggcctacagcgccagcaagggcgcgatcgtccaactgaccagatcgctg
gcctgcgagtacgccggccagcgcatccgggtcaacgccatcgcccccggctggatcgac
acgccgctgggcgccgggctcaaggccgacgccgaagccacccggcggatcatgcagcgc
acgccgctggcgcgctggggcgcagcggccgaggtggccagcgccgcggccttcctctgc
ggtcccggcgccagcttcgtcaccggcgccgtgctggcggtggacggcggctacctctgc
gcctga

DBGET integrated database retrieval system