KEGG   Pseudomonas aeruginosa PA7: PSPA7_1001Help
Entry
PSPA7_1001        CDS       T00569                                 

Definition
(GenBank) putative MFS transporter
Organism
pap  Pseudomonas aeruginosa PA7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_1_like Nuc_H_symport LacY_symp
Motif
Other DBs
NCBI-ProteinID: ABR82746
UniProt: A6V002
LinkDB All DBs
Position
complement(1003087..1004346)
Genome map
AA seq 419 aa AA seqDB search
MAHNNNSASYENVLLCVLFLTFGFVFFDRLALSFLFPFMEQELQLSNSHLGMLSSVLALA
WAVSGALVGAWSDRRGQRKPLLIVAVILFSLCSALSGLVGGFLGLLLFRGIMGLAEGPIL
PLSQSLMVEASSAHRRGLNMGLLQGSAAGLLGAVLGPPLLVALAEAFGWRHAFIVSLLPG
LLIAWLIWRHVRPDPPRERVPAIHAHAAKGSRLALLKSRNILLCTLISCVFVTWFIVLIS
FTPTFLVNARGFSPATMGRLMSCLGVAWVIWGFAVPAISDRLGRRPTLVAFSLLAACCPL
ALLYAPTATSLGLLLLLTYTGLGCFTLFMATIPAETVSRTAIATALGLIMGLGELIGGFV
APTVAGFAADRFGLSVVMWMSCGGALLAAVLSLFLRETAPAALARRGTPNASILQGNQP
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggcgcataacaacaattccgccagttacgaaaacgtcctgctctgcgtgctgttcctg
accttcggcttcgtcttcttcgaccgcctggcgctgtccttcctgtttcccttcatggaa
caggagctgcaactgagcaacagccacctgggcatgctttcctcggtgctggccctggcc
tgggcggtatccggcgcgctggtcggcgcctggtccgaccgccgcggccagcgcaagccg
ctgctgatcgtcgcggtgatcctgttctcgctgtgctcggcgttgtccgggctggtcggc
ggcttcctcggcctgctgctgttccgcggcatcatggggctggccgaggggccgatcctg
ccgctctcgcaatcgctgatggtcgaggcctcctcggcgcatcgccgcggcctcaacatg
ggcctgctgcagggctcggccgccggcctgctcggcgcggtgctcggcccgccgctgctg
gtggccctggccgaagccttcggctggcgccacgccttcatcgtctcgctgttgccgggg
ctgctgatcgcctggctgatctggcgccacgtgcgccccgatccaccccgcgaacgggtc
ccggcaattcacgcgcacgccgcgaaaggcagccgcctggcactgctgaagagccgcaac
atcctgctctgcaccctgatcagctgcgtattcgtcacctggttcatcgtgctgatttcc
tttaccccgacctttctggtcaatgcccgcggcttcagcccggcgaccatgggcaggctg
atgagttgcctgggcgtcgcctgggtgatctggggtttcgccgtgccggcgatctccgac
cgcctcggccgccggccgaccctggtggcgttctcgctgctcgccgcctgctgcccgctg
gcgctgctctacgcgccgaccgcgaccagcctcggcctgctgttgctgctgacctacacc
gggctcggctgcttcaccctgttcatggccaccatcccggcggaaaccgtctcgcgtacc
gccatcgccaccgccctcggcctgatcatgggcctgggcgaactgatcggcggcttcgtc
gcgcccaccgtcgccggtttcgccgccgaccgcttcggcctttccgtggtcatgtggatg
tcctgcggcggcgccctgctcgccgccgtcctctcgctgttcctgcgcgaaaccgcgccg
gccgcgctggcccgccgcggcacgccgaacgcttccatcctgcaaggaaaccaaccatga

DBGET integrated database retrieval system