KEGG   Pseudomonas aeruginosa PA7: PSPA7_1002Help
Entry
PSPA7_1002        CDS       T00569                                 

Definition
(GenBank) hypothetical protein
  KO
K05913  2,4'-dihydroxyacetophenone dioxygenase [EC:1.13.11.41]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
pap01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pap00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00363 Bisphenol degradation
    PSPA7_1002
Enzymes [BR:pap01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.41  2,4'-dihydroxyacetophenone dioxygenase
     PSPA7_1002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_2 Cupin_7
Motif
Other DBs
NCBI-ProteinID: ABR85495
UniProt: A6V003
LinkDB All DBs
Position
complement(1004417..1004950)
Genome map
AA seq 177 aa AA seqDB search
MPELATREFWKDLQPIPDCFKPDAKPEVYLRNAPTEDERLYVPFTETVKSRPLWISPSEN
RWCDILMATSAGLVNRHYHPHEVFAYTISGKWGYLEHDWTATAGDFVYETPGEGHTLVAY
EHEQPMRAFFIVKGPLVWLDEKGNADGIFDVHDYIAMCRAHYDKIGVGAAYIDSLFR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaactcgccacccgtgaattctggaaagacctgcaaccgattcccgactgcttc
aagccggacgccaagcccgaggtctacctgcgcaacgcgccgaccgaggacgagcgcctc
tacgtgcccttcaccgagaccgtgaagtcgcgcccgctgtggatctcgccaagcgagaac
cgctggtgcgacatcctgatggcgacgagcgccggcctggtcaaccgccactaccacccg
cacgaggtgttcgcctacaccatcagcggcaagtggggctacctggagcacgactggacc
gccaccgccggcgacttcgtctacgagacgcccggcgagggccataccctggtggcctac
gagcacgagcagccgatgcgcgcgttcttcatcgtcaagggcccgctggtctggctcgac
gagaagggcaacgcggacggcatcttcgacgtccacgactacatcgcgatgtgccgcgcc
cactacgacaagatcggcgtcggcgccgcctacatcgactccctgttccgctga

DBGET integrated database retrieval system