KEGG   Pseudomonas aeruginosa PA7: PSPA7_2583Help
Entry
PSPA7_2583        CDS       T00569                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
pap00020  Citrate cycle (TCA cycle)
pap00480  Glutathione metabolism
pap01100  Metabolic pathways
pap01110  Biosynthesis of secondary metabolites
pap01120  Microbial metabolism in diverse environments
pap01130  Biosynthesis of antibiotics
pap01200  Carbon metabolism
pap01210  2-Oxocarboxylic acid metabolism
pap01230  Biosynthesis of amino acids
Module
pap_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pap_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSPA7_2583
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PSPA7_2583
Enzymes [BR:pap01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     PSPA7_2583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: ABR86332
UniProt: A6V4G2
LinkDB All DBs
Position
complement(2604767..2606992)
Genome map
AA seq 741 aa AA seqDB search
MSIRSKITYTFTDEAPALATYSLLPIVKAFAASAGIDVETSDISLAGRILANFADRLEAD
QRIEDDLARLAVLATSPDANIIKLPNISASVPQLKGAIAELQALGYKVPDFPEDPQTDEE
KEVRARYAKILGSAVNPVLREGNSDRRAPAAVKAYARKHPHSMGKWSMASRSHADYMRGG
DFFSSEQSITMAKAGDVRIEFVGKDGKVEVKKQLSLQEGEVLDSMFMSCGKLRDFFEKTL
QDCKETGVMWSLHVKATMMKISHPIVFGHAVSVYYKDVFDKWGQLFEELGVNPNNGISSV
YDKIKSLPASQQEEILHDIHEVYSHRPEMAMVDSVKGITNLHIPSDVIVDASMPAMIRNS
GQMWGKDGKQKDTKAVMPESTYARIYQEMINFCKTNGAFDPTTMGSVPNVGLMAQKAEEY
GSHDKTFEMTADGTMRVVLADGTVLMQHEVETGDIWRACQTKDAPIRDWVKLAVTRARQS
DTPAIFWLDPERAHDRELRKKVELYLKDHDLTGLDISIMGYNEAIRVSMERLIRGKDTIS
VTGNVLRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVQQLVEENYLR
WDSLGEFLALAVSLEETGIKTGNAKAKLLGKALDEATGKLLDNNKSPSRKVGDIDNRGSH
FYLAMYWAQALAAQDEDAELKAHFAPLAKALTEQEATIVAELNAVQGKPAEIGGYYRSNP
ELTSKVMRPSATFNAAIDSLA
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgtccatccgctcgaagatcacctacaccttcaccgacgaagcacccgcgctcgccacc
tactcgctcctccccatcgtcaaggcctttgccgcttccgccggcatcgacgtcgagacc
agcgacatctctcttgcaggacgcatcctggccaacttcgccgaccgcctcgaagccgac
cagcgtatcgaagacgacctcgcccgcctggcggtcctggccacctcgcccgacgccaac
atcatcaagttgcccaacatcagcgcctcggtgccgcagctcaaaggcgcgatcgccgaa
ctgcaggccctgggctacaaggttcccgacttcccggaagacccgcagaccgacgaagag
aaagaggttcgcgcacgctacgcgaagatcctcggcagcgccgtgaacccggtcctgcgc
gaaggcaactccgaccgccgtgccccggccgcggtgaaggcctacgcccgcaagcacccg
cactccatgggcaagtggagcatggcctcgcgctcgcacgccgactacatgcgcggcggc
gacttcttctccagcgaacagtcgatcaccatggccaaggccggtgacgtgcgcatcgaa
ttcgtcggcaaggacggcaaggtcgaggtcaagaagcaactgagcctgcaggaaggcgaa
gtgctcgacagcatgttcatgagctgcggcaagctgcgcgacttcttcgagaagaccctg
caggactgcaaggaaaccggcgtcatgtggtccctgcacgtcaaggcgaccatgatgaag
atttcccacccgatcgtcttcggacatgcggtgagcgtctactacaaggacgtcttcgac
aagtggggccaactcttcgaagagctcggcgtgaacccgaacaacggcatctccagcgtc
tacgacaagatcaagtcgctgcccgcctcccagcaggaagagatcctccacgacatccac
gaggtgtacagccaccgcccggaaatggcgatggtcgactccgtgaagggcatcaccaac
ctgcacattccgagcgacgtcatcgtcgacgcctcgatgccggcgatgatccgcaactcc
ggccagatgtggggcaaggacggcaagcagaaagataccaaggcggtaatgccggaaagc
acctacgcccgcatctaccaggagatgatcaacttctgcaagaccaacggcgccttcgac
ccgaccaccatgggcagcgtgccgaacgtcggcctgatggcgcagaaggccgaggaatac
ggctcccacgacaagaccttcgaaatgaccgccgacggcaccatgcgcgtggtcctggcc
gacggcaccgtgctgatgcagcacgaagtggagaccggcgacatctggcgcgcctgccag
accaaggacgcgccgatccgcgactgggtcaagctggccgtcacccgcgcccgccagtcc
gacaccccggcgatcttctggctggacccggagcgcgcccacgaccgcgagctgcgcaag
aaggtcgagctttacctcaaggaccacgacctgaccggcctcgacatcagcatcatgggc
tacaacgaggcgatccgcgtgagcatggagcgcctgatccgcggcaaggacaccatctcg
gtgaccggcaacgtcctgcgcgactacctgaccgacctgttcccgatcatggaactgggc
acctcggccaagatgctctccatcgttccgctgatggcgggcggcggcatgtacgaaacc
ggcgccggcggctcggcacccaagcacgtccagcaactggtggaagagaactacctgcgc
tgggactccctgggcgagttcctggccttggccgtatccctggaggaaaccgggatcaag
accggcaacgccaaggccaagctgctcggcaaggcactggacgaagccactggcaagctg
ctggacaacaacaagtcgccgtcgcgcaaggtcggtgacatcgacaaccgcggcagccac
ttctacctggcgatgtactgggcccaggccctggccgcccaggacgaagacgccgaactg
aaagcgcatttcgcaccgctggccaaggccctgaccgagcaggaagcgaccatcgtcgcc
gaactcaacgccgtccagggcaagccggccgagatcggcggctactatcgctccaatccg
gagctgaccagcaaggtaatgcgccccagcgccaccttcaacgcggcgatcgacagcctg
gcctga

DBGET integrated database retrieval system