KEGG   Pseudomonas aeruginosa PA7: PSPA7_2829Help
Entry
PSPA7_2829        CDS       T00569                                 

Definition
(GenBank) probable non-ribosomal peptide synthetase
Organism
pap  Pseudomonas aeruginosa PA7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: ABR80793
UniProt: A6V554
LinkDB All DBs
Position
2871014..2884042
Genome map
AA seq 4342 aa AA seqDB search
MMDAFELPTTLVQALRRRAVQEPERLALRFLAEDDGEGVVLSYRDLDLRARSIAAALQAH
AQLGERAVLLFPSGPDYVAAFFGCLYAGVIAVPAYPPESARRHHQERLLSIIADAEPRLV
LTSADLREPLLQMNAQLSAANAPQLLCVDQLDPAGAEAWQEPALRPEHIAFLQYTSGSTA
LPKGVQVSHGNLVANEVLIRRGFGIGADDVIVSWLPLYHDMGLIGGLLQPIFSGVPCVLM
SPRYFLERPVRWLEAISQYGGTVSGGPDFAFRLCSERVAESALQRLDLSGWRVAFSGSEP
IRQDSLERFAGKFAASRFDASSFFACYGLAEATLFVTGGQRGQGIPALAVDGEALARNRI
AEGEGSVLMCCGRSQPEHAVRIVDAASGEVLGDDSVGEIWAAGPSIAHGYWRNPEASAKT
FVERDGRTWLRTGDLGFLRDGELFVTGRLKDMLIVRGHNLYPQDIERTVESEVPSARKGR
VAAFAVKVDGEEGIGIAVEIGRGIQKSVPARELIDSIRQAVAEVCQEAPKVVALLNPGAL
PKTSSGKLQRSACRLRLEDGSLDSYAQFPGLEANEEHGATPDDDELLACIGEIWKAQLGV
AQVAPRDHFFLLGGNSIGAAQVVAQVRDSLGVALNLRQLFEAPTLQGFSAVVARQLAEGA
AEEAPIAHLPRGIDLPQSAAQQRLWLTWQIDPRGAAYNIPGGLRLRGELDEAALRASFQR
LVERHEALRTRFLERDGVALQRIDERGEFAWQFIDLARLAEHERAAAAAQRREAEAQQPF
DLEKGPLLRVSLVRLDEQEHQLWVTLHHIVADGWSLNLLLDEFSRLYAEACGGQPADLAP
LELHYAEFAAWQRQWLDAGEGARQLAYWRERLGDAAPVLELATDHPRTARQASPAARYSL
RVDEALARAIREAALDHEASVFMWLLAAFQALLHRHSGQGEIRIGVPSANRQRLETQGLV
GFFINTLVLRGRPRARQPFAALLGEAREATLGAQANQDLPFDQVLAACGQGGQLFQVLFN
HQQRDLSALRRLPGLLADELPWHSREAKFDLQLQSEEDARGRLTLNFDYAADLFDEASIR
RFAAQYLELLRQVAEDPQRCLGDIALVDAEQAARLAEWGSAPCAPARAWLPVLLERQLAQ
SAERVALEWDGGSLGYAELHARANRLAHYLRDKGVGPDVRVAICAERSPQLLVGLLAIVK
AGGAYVPLDPDYPSERLAYMLADSGVELLLTQAHLFERLPGAEGVTPICLDSLKLDSWPS
QAPGLHLHGDNLAYVIYTSGSTGQPKGVGNTHAALAERLQWMQATYALDGDDVLMQKAPV
SFDVSVWECFWPLLTGCRLVLAAPGEHRDPARLVELVRQFGVTTLHFVPPLLQLFIDEPG
VAACGSLRRLFSGGEALPAELRNRVLQRLPAVALHNRYGPTETAINVTHWQCRAEDGERS
PIGRPLGNVVCRVLDAEFNLLPAGVAGELCIGGQGLARGYLGRPALSAERFVADPFSADG
ERLYRTGDRARWNADGVLEYLGRLDQQVKLRGFRIEPEEIQARLLAQPGVAQAVVVIREG
VAGSQLVGYYTGAAGAEAEAEQNQRLRAALQAELPEYMVPAQLMRLAQMPLGPSGKLDTR
ALPEPVWQQREHVEPQTELQRRIAAIWSEVLGLPRVGLRDDFFELGGHSLLATRIVSRTR
QACDVDLPLRALFEASELEVFCEQVRAAQAAGRTDSHGAIRRIDREQPVPLSYSQQRMWF
LWQLEPDSPAYNVGGLARLSGPLDVARFEAALQALVQRHETLRTTFPSVDGVPVQRVHGD
GGLHMDWQDFSALDRDSRQQHLQTLADSEAHRPFDLESGPLLRVCLVKMAEREHYLVVTL
HHIVTEGWAMDIFARELGALYEAFLDDRESPLEPLPVQYLDYSVWQREWLDSGERQRQLD
YWKAQLGNEHPLLELPGDRPRPPVQSHRGDLYRFDLSPELAERVRRFNAARGLTMFMTMT
ATLAALLYRYSGQQDLRIGAPVANRIRPESEGLIGAFLNTQVLRCRLDGQMSVGELLEQV
RQTVIDGQSHQDLPFDHLVEALQPPRSAAYNPLFQVMCNVQRWEFQQTRQLAGMTVEYIA
NDARATKFDLNLEVTDLDQRLGCCLTYSRDLFDEPRIARMAGHWQNLLEALLGDPQRRIA
ELPLFAAEEREQLLLAGTAGEAGLQDTLHGLFAARVAASPQAPALTFAGQTLSYAELDAR
SNRLARVLRRHGVGPEVRVGLALERSLEMVVGLLAILKAGGAYVPLDPEYPLERLQYMIE
DSGVRLLLSHAALFEALGELPAGVARWCLEEDAAALDAEDPAPLAALSGPQHQAYLIYTS
GSTGKPKGVAVSHGEIAMHCAAVIERFGMRADDCELHFYSINFDAASERLLAPLLCGARV
VLRAQGQWGAEEICELIRAEGVSILGFTPSYGSQLAQWLEGQGRQLPVRMCITGGEALTA
EHLQRIRQAFAPASFFNAYGPTETVVMPLACLAPECLEEGAASVPIGSVVGARVAYILDA
DLALVPQGATGELYVGGAGLARGYHERPALSAERFVPDPFAAEGGRLYRTGDLVRLCDNG
LVEYVGRIDHQVKIRGFRIELGEIEARLLEHPQVREALVLALDSPSGKQLAGYVASAVAA
QDEDAQAALREALKTHLKQQLPDYMVPAHLLLLASLPLTANGKLDRRALPAPDPALNRQA
YEAPRSVLEQQLAGVWREVLNVERVGLGDNFFELGGDSILSIQVVSRARQLGIHFSPRDL
FQHQTVQSLAAVARHSQASQAEQGPVQGDSALTPIQHWFFDLPLVRREHWNQSLLLQPRQ
AIDLGLLRKSLQRLVEQHDALRLAFRQVDGEWLAQHRPLREQELLWHVPVQSFDECAELF
AKAQRSLDLEQGPLLRAVLVDGPAGEQRLLLAIHHLAVDGVSWRVLLEDLQQVYRQLAAG
AEPSLPAKTSAFRDWAGRLQAYAGSESLREELGWWQARLGGQPAEWPCDRPQGDNREALA
ESLSLRLDPQRTRQLLQQAPAAYRTQVNDLLLTALARVLCRWSGQPSALVQLEGHGREAL
FDDIDLTRSVGWFTSAYPLRLTPAQSPGESIKAIKEQLRAVPHKGLGYGVLRYLADPAVR
QAMAALPTAPITFNYLGQFDQSFTDALFQPLDQPTGPIHDEQAPLPNELSVDGQVYGGEL
VLRWTYSRERYDARTVNELAQAYLAELQALIEHCLEDGAGGLTPSDFPLAQLSQAQLDAL
AVPAGEIEDVYPLTPMQEGLLLHTLLEPGTGIYYMQDRYRIDSPLDPERFAAAWQAVVAR
HEALRASFVWNAGETMLQVIHKPGRTRIEFLDWGELPEDGHEERLQALHKREREAGFDLL
EQPPFHLRLIRLGEARYWFMMSNHHILIDAWCRGLLMNDFFEIYGALGEGRTANLPTPPR
YRDYIAWLQRQDLEQSRRWWSESLRGFERPTLVPSDRPFLREHAGESGGMIVGDRYTRLD
AADGARLRELAQRYQLTVNTFAQAAWALTLRRFSGERDVLFGVTVAGRPVGMPEMQRTVG
LFINSIPLRVRMPAAGQRCTVREWLNRLFERNLELREHEHLPLVVIQESSELPKGQPLFD
SLFVFENAPVEVSVLDRAQSLNASSDSGRTHTNFPLTVVCYPGDDLGLHLSYDQRYFEAP
TIERLLGEFKRLLLALVDGFHGELEALPLLGEDERVFLLDGCNRSARDYPLEQGYVRLFE
AQVAAHPQRIAASCLEQRWSYAELNRRANRLGHALRAAGVGIDQPVALLAERGLDLLGMI
VGSFKAGAGYLPLDPGHPTQRLTRIVELSRTPVLVCTQACREQALALFDELGCAARPRLL
VWDEIQQGAGAEHDPQVYSGPQNLAYVIYTSGSTGLPKGVMVEQAGMLNNQLSKVPYLEL
DENDVIAQTASQSFDISVWQFLAAPLFGARVAIVPNAIAHDPQGLLAHVGEQGITVLESV
PSLIQGMLAEERQALDGLRWMLPTGEAMPPELARQWLKRYPRIGLVNAYGPAECSDDVAF
FRVDLASTESTYLPIGSPTDNNRLYLLGAGADDAFELVPLGAVGELCVAGTGVGRGYVGD
PLRTAQAFVPHPFGAPGERLYRTGDLARRRADGVLEYVGRIDHQVKIRGFRIELGEIEAR
LHERADVREAAVAVQDGANGKYLVGYLVPGETPRSSADSPAGLMVEQGAWFERIKQQLRA
DLPDYMVPLHWLVLERMPLNANGKLDRKALPALDIGQMQNQAYQAPRNELEETLARIWAE
VLKVERVGVFDNFFELGGHSLLATQIASRVQKALQRNVPLRAMFECSTVEELASYIESLA
PSEISEQKAERLNDLMSKLEML
NT seq 13029 nt NT seq  +upstreamnt  +downstreamnt
atgatggacgccttcgaactccccaccaccctggtccaggccctgcgtcgccgcgccgtc
caggagcccgagcgcctggcgctgcgcttcctcgccgaggacgatggcgaaggcgtggtc
ctcagctaccgcgatctcgacctgcgcgcgcggagcatcgccgcggccctgcaggcccat
gcgcagctgggcgagcgcgcggtgctgctgtttcccagcggccccgactacgtcgcggcg
ttcttcggctgcctgtatgccggggtcatcgcggtgccggcctatccgccggaatcggcg
cgccgccatcaccaggagcgcctgttgtcgatcatcgccgacgccgagccgcgcctggtc
ctcaccagcgccgacctgcgcgagccgctgctgcagatgaacgcgcaactgtccgccgcc
aatgcgccgcagctgctctgcgtggaccagctggacccggctggcgccgaggcctggcag
gagccggcgctgcgccccgagcacatcgccttcctgcagtacacctcaggttccaccgcg
ttgcccaagggcgtccaggtcagccatggcaacctggtcgccaacgaggtgctgatccgc
cgcggcttcggcatcggtgccgacgacgtgatcgtcagctggctgccgctgtaccacgac
atgggcctgatcggcggcttgctgcaaccgatcttcagcggcgtaccctgcgtgctgatg
tcgccgcgctacttcctcgaacgcccggtgcgctggctggaagccatcagccagtatggc
ggcaccgtcagtggcggcccggacttcgccttccgcctgtgcagcgagcgggtcgccgag
tcggccttgcagcgtctcgacctgagcggctggcgggtagccttctccggctccgagccg
atccgccaggacagcctggaacgcttcgccgggaagttcgccgccagtcgcttcgacgcg
tccagtttcttcgcctgctacggcctggccgaggcgaccctgttcgttaccggcggccag
cgcggccagggcattcccgccctggcggtggatggcgaggcgctggcgcgcaaccgcatc
gccgaaggcgaaggcagcgtgctgatgtgctgcggccgtagccagccggaacacgccgtg
cggatcgtcgacgcggcgagcggcgaggtcctcggcgacgacagcgtcggcgagatctgg
gccgccgggccgagcatcgcccacggctactggcgcaacccggaagcctcggcgaagacc
ttcgtcgagcgcgacgggcgcacctggctgcgcaccggcgacctgggcttcctccgcgac
ggcgaactgttcgtcaccgggcgcctgaaggacatgctcatcgtccggggccacaacctc
tacccgcaggacatcgagcgcaccgtcgagagcgaggtgccgtcggcgcgcaaggggcgg
gtcgcggcgttcgcggtcaaggtcgacggcgaggaaggcatcggcatcgccgtcgagatc
ggccgtggcatccagaagtcggtgccggcccgcgaactgatcgactcgatccgccaggcg
gtggccgaggtctgccaggaagcgccgaaggtggtggcgctgctcaatcccggcgccttg
ccgaaaacctccagcggcaagttgcaacgttccgcctgccgcctgcgcctggaggacggc
agcctggacagctacgcgcagtttcccggcctcgaggcgaacgaggaacacggcgcgacg
ccggacgacgatgagttgctggcgtgtatcggggaaatctggaaggcccagctgggcgtg
gcgcaggtagcgccgcgcgaccatttcttcctgctcggcggcaactccatcggcgccgcc
caggtagtcgcccaggtgcgtgacagcctcggcgtcgccctcaacctgcgccagttgttc
gaagcgccgaccctgcagggtttcagcgccgtggtggcacgccaactggccgagggcgcg
gcagaggaggcgccgatcgcgcacctgccacgtggcatcgacctgccgcagtcggcggcg
cagcagcgtctctggctgacctggcagatcgatccgcggggcgccgcctacaacatcccc
ggcggcctgcgcctgcgcggcgagctggacgaagcggcgctgcgcgccagcttccagcgc
ctggtcgaacgccacgaagcgttgcgcacgcgtttcctcgagcgcgacggcgtggccttg
cagcgtatcgatgagcggggcgagttcgcctggcagttcatcgacctcgctaggctggcc
gagcacgaacgcgccgcggctgccgcgcaacgccgcgaagccgaggcgcagcagccgttc
gacctggaaaaggggccgctgctgcgggtcagcctggtgcgcctggacgaacaggagcac
caactctgggtcaccctgcatcacatcgtagccgatggttggtcgctgaacctgctgctc
gacgaattctcgcggctctacgccgaagcctgcggcggccagccggccgacctggcgccg
ctggaactgcactacgccgaattcgccgcctggcaacggcagtggctggacgcgggcgag
ggcgcccgccaactggcctactggcgggaacgcctgggcgacgcggcgccggtgctggaa
ctggccaccgaccatccgcgcacggcgcgccaggcgtcgcccgccgcgcgctacagcctg
cgggtcgacgaagccctggcgcgggccatccgcgaggccgcgctggaccatgaggcgagt
gtcttcatgtggctgctggcggcgttccaggcgctgctgcatcgccacagcgggcagggc
gagatccgcatcggcgtgcccagcgccaaccgccagcgcctggagacccaggggctggtc
ggcttcttcatcaacaccctggtcctgcgtggcaggccccgggcgcgccagccgttcgcc
gcgttgctcggcgaggctcgcgaggcgacccttggcgcccaggccaaccaggacctgccg
ttcgaccaggtgctcgcggcctgcggccagggcggccagttgttccaggtgctgttcaac
caccagcagcgcgacctgtcggcgttgcgccggctgcccggcctgctcgccgacgagctg
ccctggcacagccgcgaagccaagttcgacctgcaactgcagagcgaggaggacgctcgc
ggtcgcctgaccctgaatttcgactacgccgcggacctcttcgacgaggccagcatccgg
cgtttcgccgcgcaatacctggagctgctgcgccaggtcgcggaagacccgcagcgctgc
ctcggcgatatcgccctggtcgacgccgagcaggcggcgcgcctcgccgaatggggcagc
gcgccctgcgcgccggcgcgcgcctggctgccggttctgctggagcggcaactggcgcag
tccgccgaacgcgtcgccctggagtgggacggcggcagcctcggctacgccgagttgcac
gcccgggccaaccgtctggcccactacctgcgcgacaagggcgtcggcccggacgtgcgg
gtggcgatctgcgccgagcgttcgccgcagctgctggtcggtctgctggcgatcgtcaag
gcgggcggcgcctacgtgccgctggacccggactaccccagcgaacgcctggcctacatg
ctcgccgacagcggcgtcgagctgctcctgacccaggcccatctgttcgagcgcctgcct
ggcgcggagggcgtcacgccgatctgcctggacagcctcaagctcgacagctggccgagc
caggcgccgggcctgcacctgcacggcgacaatctcgcctacgtgatctacacctccggt
tccaccggccagccgaagggtgtgggcaatacccacgcggcgctggccgagcgcctgcaa
tggatgcaggcgacctacgccctcgacggcgacgacgtactgatgcagaaggcgccggtg
agcttcgacgtgtcggtgtgggagtgcttctggccgctgctcaccggttgccggctggtc
ctcgccgcccccggcgagcaccgcgatccggcgcgcctggtggaactggtgcggcagttc
ggggtgaccacgctgcacttcgtgccgccgctgctgcaactgttcatcgacgaacccggc
gtcgccgcctgtggcagcctgcgccgcctgttctccggcggcgaggcgctgccggcggag
ctgcgcaaccgcgtgttgcaacgcctgccggcggtggccctgcataaccgctacgggccg
accgagaccgccatcaacgtcacccactggcagtgccgcgcggaggacggcgagcgttcg
ccgatcggccggccgctgggcaacgtggtctgccgcgtactggacgccgagttcaatctg
ctgccggccggcgtcgccggcgagctgtgcatcggcggccagggcctggctcgtggctac
ctgggacgtccggcgctgagcgccgaacgcttcgtcgccgacccgttctcggccgacggc
gagcgcctgtaccgcaccggcgaccgcgcgcgctggaacgccgacggcgtgctggaatac
ctcggtcgcctcgaccagcaggtcaagctgcgtggcttccgtatcgagccggaggagatc
caggcacgcctgctggcgcagccgggcgtggcccaggcggtggtggtgatccgcgaaggc
gtggccggcagccagttggtcggctactacaccggcgctgccggcgccgaggcggaagcc
gagcagaaccagcgcctgcgcgccgcgctacaggccgaactgccggaatacatggtcccg
gcgcagttgatgcgcctggcgcagatgcccctcggtccgagcggcaagctggatacccgg
gcgctgccggagccggtctggcagcagcgcgagcacgtcgagccgcagaccgagctgcaa
cggcgcatcgccgcgatctggagcgaagtgctcggcctgccgcgggtcggcctgcgcgac
gatttcttcgagctcggcgggcattccctgctggccacccgcatcgtctcgcgcacccgc
caggcctgcgacgtcgacctgccgttgcgcgcgctgttcgaggccagcgaactggaggtc
ttctgcgaacaggtccgcgcagcccaggccgccggacgcaccgatagccacggcgcgatc
cgccgcatcgaccgcgagcagccggtgccgctgtcctactcgcagcagcgcatgtggttc
ctctggcaactggagccggacagcccggcctacaacgtcggcggcctggcgcgcctgagc
gggccgctggacgtggcgcgcttcgaggccgcgctacaggccctggtgcagcgccacgag
accctgcgcaccacgttccccagcgtcgacggcgtgccggtacagcgcgtgcacggcgat
ggcggcctgcacatggactggcaggacttctccgcgctcgaccgcgacagccgccagcag
cacttgcagaccctcgccgacagcgaggcgcaccggcccttcgacctcgagagcggaccg
ttgctgcgggtctgcctggtgaagatggccgagcgcgagcactacctggtggtgaccctc
caccacatcgtcaccgaaggctgggcgatggacatcttcgcccgcgagctgggcgcgctc
tacgaggccttcctcgacgatcgcgaatcgccgctggagccgttgccggtccagtacctg
gactacagcgtgtggcagcgcgagtggctggatagcggcgagcgccagcgccagctcgac
tactggaaggcccagctgggcaacgagcatccgctgctcgaactgccgggcgaccggcca
cgcccgccggtgcagagccaccggggcgacctctaccgcttcgacctgagccccgagctg
gccgagcgcgtgcggcgcttcaacgctgcccgcgggctgaccatgttcatgaccatgacc
gccacccttgcggccttgctctaccgctacagcggccagcaggacctgcgcatcggcgcg
ccggtggcgaaccgcatccgcccggagagcgaagggctgatcggcgccttcctcaatacc
caggtgctgcgctgccggctcgacgggcagatgagcgtcggcgagctgctggagcaggtg
cggcagaccgtgatcgatggccagtcgcaccaggacctgccgttcgaccacctggtggaa
gccctgcaaccgccgcgcagcgccgcctacaacccgttgttccaggtgatgtgcaacgtc
cagcgctgggagttccagcagacccggcaactggccgggatgaccgtcgagtacatcgcc
aacgatgcgcgggcgaccaagttcgacctcaacctggaggtcaccgatctcgaccagcgc
ctcggctgctgcctgacctacagccgcgacctgttcgacgaaccgcgcattgcacggatg
gccgggcactggcagaacctgctggaggcgctgctgggcgacccgcagcggcgtattgcc
gaattgccgctgttcgccgccgaggagcgggagcaactgctgctcgccggcacggctggc
gaggcagggctccaggacaccctccatggcctgttcgccgcccgcgtggcggccagcccc
caggccccggcgctgaccttcgccggacagaccctgagctatgccgaactcgatgcccgc
tccaatcgcctggcgcgggtcctgcgccgtcatggcgtcggcccggaagtgcgggtcggc
ctggccctggagcgttcgctggagatggtcgtcggcctgctggcgatcctcaaggccggc
ggcgcctacgtgccgctggacccggagtatccgctggagcgcctgcaatacatgatcgag
gacagcggcgtacgcctgctgctcagccacgcggcgctgttcgaggccctcggcgagctg
ccggcgggcgtggcgcgctggtgcctcgaggaggacgccgcggcgctggacgccgaggac
cccgcgccgctggcagcgctgagcggtccgcagcaccaggcctacctgatctatacctcc
ggttccaccggcaagccgaagggcgtggcggtctcccacggcgagatcgccatgcactgc
gccgcggtgatcgagcgcttcggcatgcgcgccgacgattgtgaactgcacttctattcg
atcaacttcgacgccgccagcgagcgcctgctggccccgttgctgtgcggcgcccgtgtg
gtgctgcgggcccagggccagtggggcgcggaggaaatctgcgagctgatccgcgcggag
ggcgtgagcatcctcggcttcactccgagctacggcagccagctcgcccagtggctggag
ggccagggccggcagttgccggtgcgcatgtgcatcaccggcggcgaagcgctgaccgcc
gagcacctgcaacggattcgccaggccttcgccccggcgtcgttcttcaatgcctacgga
ccgaccgagacggtggtcatgccgctggcctgcctggctcccgaatgtctggaagagggc
gccgccagcgtgccgatcggcagcgtggtcggcgcgcgggtcgcctacatcctggatgcc
gacctggccctggtgccgcagggcgcgaccggcgagctctacgtcggcggcgccggcctg
gcccgcggctaccatgagcgtccagcgctcagcgccgagcgcttcgtgcccgatcccttc
gctgccgagggcggccggctgtaccgcaccggcgacttggtgcgcctgtgcgacaacggc
ctggtggaatatgtcggacgcatcgaccatcaggtgaagatccgtggcttccgcatcgaa
ctgggcgagatcgaggcgcgcctgctggagcatccgcaggttcgcgaagcgctggtcctg
gcgctcgacagcccgagcggcaagcagttggccggttatgtcgccagcgcggtggccgcg
caggacgaggacgcccaggcggcgctgcgcgaggcgctgaaaacgcacctcaagcagcaa
ttgccggactacatggtgccggcccacctgctgctgctcgccagcctgccgctgaccgcc
aacggcaagctcgaccgccgtgcgctgccggcgcccgatccggcgctcaaccggcaggcc
tacgaggccccgcgcagcgtgctggaacagcagctggccggggtctggcgcgaggtgctg
aacgtcgagcgggtgggcctcggcgacaacttcttcgaactgggcggcgactcgatcctg
tcgatccaggtggtcagccgcgcccgccagctcggcatccacttcagcccccgcgacctg
ttccagcaccagaccgtgcagagcctcgccgcggtggcccggcacagccaggccagccag
gccgagcaggggccggtgcagggcgacagcgcgctgacgccgatccagcactggttcttc
gacctgccgctggtgcgccgcgagcactggaaccagtcgctgctgttgcagccgcggcag
gccattgacctcggtctgctgcgcaagtcgctgcaacgcctggtcgagcagcatgacgcc
ctgcgcctggcgttccgccaggtcgacggcgagtggctggcgcagcatcgtccgctgcgc
gaacaggaactgctctggcacgtcccggtgcaatccttcgacgaatgcgccgagctgttc
gccaaggcccagcgcagcctcgacctcgaacagggtccgctgctgcgcgcagtgctggtg
gacggcccggccggcgagcaacgcctgctgctggcgatccaccacctggcagtggacggg
gtgtcctggcgggtgttgctggaagacctgcaacaggtctaccgccagcttgccgccggc
gccgaaccatcgctgccggccaagaccagcgccttccgcgactgggccggacgccttcag
gcctacgccggcagcgaatcgctgcgcgaggagctgggctggtggcaagcccggctgggc
gggcagccggccgagtggccgtgcgaccgtccgcagggcgacaaccgcgaggcgctggcg
gaaagcctcagcctgcggctcgacccgcaacgtacccggcaattgctgcaacaggcgccg
gcggcctaccgcacccaggtcaacgacctgctgctgaccgccctcgctcgcgtgctctgc
cgctggagcgggcagccatcggcgctggtgcagttggaagggcatggccgcgaggcactg
ttcgacgatatcgacctgacccgtagcgtcggctggttcaccagcgcctacccgttgcgc
ctgaccccggcgcagagcccgggcgagtcgatcaaggcgatcaaggaacagctccgcgcg
gtgccgcacaagggcctcggctacggcgtgctgcgctacctcgccgatccggcggtgcgc
caggcgatggccgcgctgccgacggcgccgatcaccttcaactacctcgggcagttcgac
cagagcttcaccgacgccctgttccagccgctggaccagcccaccgggccgatccacgac
gagcaggcgccgttgcccaacgagctgagcgtcgatggccaggtctacggcggcgagctg
gtgctgcgctggacctacagccgcgagcgctacgacgcgcggacggtgaacgagctggcg
caggcctatctcgccgaactgcaggcgctgatcgagcattgcctggaagacggcgccggc
ggcctgaccccgtccgacttcccgctggcgcaactgagccaggcgcaactggacgccctg
gcggtgccggccggcgagatcgaggacgtctacccgctgaccccgatgcaggaagggctg
ctgttgcacaccctgctggaaccgggcaccggcatctactacatgcaggatcgctaccgg
atcgacagcccgctcgatcccgagcgcttcgccgccgcctggcaggcggtggtggcccgc
cacgaggcgctgcgcgcgtcgttcgtctggaatgccggcgaaaccatgctgcaggtgatc
cacaagcccggccgcactcgcatcgagttcctcgactggggcgagctgccggaggacggt
cacgaggaacgcctgcaagcgctgcacaagcgcgagcgcgaggccggcttcgatctgctc
gaacagccgccgttccacctgcgcctgatccgcctgggcgaggcgcgctactggttcatg
atgagcaaccaccacatcctcatcgatgcctggtgccgtggtctgctgatgaacgacttc
ttcgagatctacggcgccctcggcgaaggccgcacggcgaacctgccgacgccaccgcgc
taccgtgactacatcgcctggctgcaacgccaggacctggagcaatcgcgccgctggtgg
agcgagagcctgcgcggcttcgaacggccgaccctggtgcccagcgaccgaccgttcctc
cgcgagcacgccggcgagagcggcgggatgatcgtcggtgaccgctacacgcgtctggac
gccgccgacggcgcgcgcctgcgcgaactggcgcagcgctaccagctcaccgtcaacacc
ttcgcccaggccgcctgggcgctgaccctgcgccgcttcagcggcgagcgcgacgtgctc
ttcggcgtcaccgtggccgggcgtccggtgggcatgccggaaatgcagcgcaccgtcggc
ctgttcatcaacagcatcccattgcgcgtgcggatgccggccgccggccagcgctgcacg
gtgcgcgaatggctgaaccggctgttcgagcgcaacctggagttgcgcgagcacgagcac
ctgcccctggtggtcatccaggaaagcagcgagctgcccaagggccagccgctgttcgac
agcctgttcgtgttcgagaacgccccggtggaagtctcggtgctggaccgcgcgcagagc
ctgaacgccagttccgactccgggcgtacccacaccaacttcccgctgaccgtggtctgc
tatccgggcgatgacctcggcctgcacctgtcctacgaccagcgctacttcgaggcgccg
accatcgagcgtctgctcggcgagttcaagcgcctgctgctggccctggtcgacggattc
cacggcgaactggaggccttgccgctgctcggcgaggacgagcgcgtcttcctcctcgac
ggctgcaaccgcagcgcccgcgactacccgctggagcaaggctacgtgcggctgttcgag
gcgcaggtggcggcccatccgcagcgcatcgccgccagttgcctggagcagcgctggagc
tatgccgagctgaaccgccgggccaatcgcctcggccacgccctgcgtgccgccggcgtc
ggcatcgaccagccggtggcactgctggccgagcgcggcctcgacctgctcggcatgatc
gtcggcagcttcaaggccggtgccggctacctgccgctcgaccccggccatccgacccag
cgcctgacccggatcgtcgagctgagccgcacgccggtactggtctgcacccaggcctgc
cgcgagcaggcgctggcgctgttcgacgaactcggctgcgccgcccggccgcgcctgctg
gtgtgggacgagatccagcagggcgcgggcgccgagcacgatccgcaggtctacagcggg
ccgcagaacctcgcctacgtgatctacacctccggctccaccggactgccgaagggcgtg
atggtggagcaggcgggcatgctcaacaaccagttgagcaaggtcccgtacctggaactg
gacgagaacgacgtgatcgcccagaccgcctcgcagagcttcgacatctcggtctggcag
ttcctcgccgcgccgttgttcggcgcccgcgtggcgatcgtgccgaacgccatcgcccac
gatccgcaaggcctgctggcgcacgtcggcgaacagggcatcacggtgctggaaagcgtg
ccgtcactgatccagggcatgctcgccgaggagcgccaggccctcgacggcctgcgctgg
atgttgcccaccggcgaggcgatgccgccggagctggcacgccagtggctcaagcgctac
ccgcggatcggcctggtgaatgcctacgggccggcggagtgttccgacgacgtggcgttc
ttccgcgtcgacctggcctccaccgagagcacctacctgccgatcggcagtcccaccgac
aacaaccgcctgtacctgctcggcgccggcgccgacgacgccttcgaactggtgccgctg
ggcgcggtgggcgagctgtgcgtggccggcaccggcgtcggtcgtggctacgtcggcgat
ccgctgcgcaccgcccaggccttcgtcccgcatccgttcggcgcgccgggcgagcgcctg
taccgtaccggcgacctggcgcggcggcgcgccgacggggtgctggaatatgtcgggcgg
atcgaccaccaggtgaagatccgcggcttccgcatcgagctgggcgagatcgaggcgcgc
ctgcacgaacgcgccgacgtccgcgaggcggcggtggcggtgcaggacggggcgaacggc
aagtacctggtgggctacctggttcccggcgagacaccgcgttccagcgccgactcgccg
gccggactgatggtggagcagggcgcctggttcgagcggatcaagcagcaactgcgcgcc
gacctgccggactacatggtgccgctgcactggctggtgctggagcggatgccgctcaac
gccaacggcaagctcgaccgcaaggcgctgccggcgctggatatcggccagatgcagaac
caggcctaccaggccccgcgcaacgaactggaggaaaccctggcgcggatctgggccgag
gtgctgaaggtcgagcgggtcggggtgttcgacaacttcttcgaactcggcgggcattcg
ctgctggccacgcagatcgcctcgcgggtgcagaaggccctgcaacgcaacgtgccgcta
cgggcgatgttcgaatgcagcacggtggaagagctggccagctacattgagtccctggcc
ccgagcgagatcagcgagcagaaggccgagcgcctgaacgacctgatgtcgaagctggaa
atgctctga

DBGET integrated database retrieval system