KEGG   Pseudomonas aeruginosa PA7: PSPA7_3154Help
Entry
PSPA7_3154        CDS       T00569                                 

Definition
(GenBank) probable trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
pap00500  Starch and sucrose metabolism
pap01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PSPA7_3154
Enzymes [BR:pap01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     PSPA7_3154
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     PSPA7_3154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap Apolipoprotein
Motif
Other DBs
NCBI-ProteinID: ABR84447
UniProt: A6V629
LinkDB All DBs
Position
complement(3268187..3271489)
Genome map
AA seq 1100 aa AA seqDB search
MARREKPVFLNDPQWYKDAVIYQVHVKSFYDANNDGIGDFAGLIEKLDYIADLGVNTLWL
LPFYPSPRRDDGYDIAQYRGVHSDYGSLADARRFIAEAHRRGLRVITELVINHTSDQHPW
FIRARHAKKGSRARDYYVWSDSDEKYQGTRIIFIDTEQSNWTWDPVAQQYYWHRFYSHQP
DLNFDNPQVLREVLGVMRYWLDMGVDGLRLDAIPYLIERDGTSSENLPETHQVLKRIRAE
LDTHYPDRMLLAEANQWPEDTRPYFGGEDGGEGDECHMAFHFPLMPRMYMAIAQEDRYPI
TDILRQTPDIPANCQWAIFLRNHDELTLEMVTDDERDYLWNHYAADRRARLNLGIRRRLA
PLVERDRRRIELLHSLLLSMPGTPTLYYGDEIGMGDNIYLGDRDGVRTPMQWSVDRNGGF
SRADPAKLVLPPILDPLYGYQTINVEAQARDPHSLLNWMRRLLAVRSQQRAFGRGSLKML
APSNRRILAYLREYAEGERRDSILCVANLSRAAQAVELDLAAHAGKVPVEMVGGMSFPPI
GELTYLLTLPPYGFYWFYLADAAQMPSWHVAADERLPELPTLVVKQRLGELLQGASRDIL
EGETLPAYLPKRRWFAGEKGQPRLCYIVPVDEAEPRCALCELEIDGLRYQLPLGFLDADQ
RGDSLPQLLALARLRRGRKVGLLTDAASLPLFARRVLAQLRAEALIAHGDGEIQFVPAVG
LAELDDIADEEVLPFAVEQSNSSIRFGERMVLKVLRKILPGLHPEIEVGGYLTRHGYPGI
APLLGEVRRVDAAGVPHTLAILQGYLSNQGDAWNWTLDNLERAVRDEISGASEALEGQYD
SLAELRGFAANLGARLGEMHSVLAGESDDPAFGSRESDDASVQAWALRIAEQLREAAERL
GEPPRPLQGEAAEQARHLLERLPALLERLPLLARQAAGGLLIRVHGDLHLGQVLMVQGDA
RFIDFEGEPARSLEERRQRHSPMKDVGGMLRSFDYAAAMVLRNAQSTDSSEQADSARRKV
ATRYRGEARDAFLAGYRAAAAGLAHAWHGREGEGAALALACLEKAAYELLYEADYRPDWL
EVPLAGLAELTEHLLKGKNR
NT seq 3303 nt NT seq  +upstreamnt  +downstreamnt
atggccagacgcgagaaaccggtcttcctcaacgacccgcaatggtacaaggacgcagtg
atctaccaggtccacgtgaagtccttctacgatgccaacaacgacggcatcggcgacttc
gccgggctgatcgagaaactcgactatatcgccgacctcggcgtgaacaccctctggctg
ctgccgttctacccctcgccgcgccgcgacgacggctacgacatcgcccagtaccgtggc
gtgcacagcgactacggcagcctcgccgacgctcgccgcttcatcgccgaggcccatcgg
cgcggcctgcgggtgatcaccgaactggtgatcaatcacacctccgaccagcatccctgg
ttcatccgcgcccgccacgcgaagaaggggtcgcgcgcccgcgattactacgtgtggtcg
gacagtgacgagaaataccagggcacgcggatcatcttcatcgacaccgagcagtccaac
tggacctgggacccggtcgcccagcagtattactggcaccgcttctattcccaccagccg
gacctgaacttcgacaacccgcaggtgctgcgcgaggtgctcggggtcatgcgctactgg
ctggacatgggcgtcgacggcctgcgcctggacgcgattccctacctgatcgaacgcgac
ggcaccagcagcgagaacctgccggaaacccaccaggtgctcaagcgcatccgcgccgaa
ctggacacgcattatcccgaccgcatgctgctggccgaggccaaccagtggccggaggac
acccggccgtatttcggcggcgaggatggcggcgagggcgacgaatgccacatggccttc
catttcccgctgatgccgcgcatgtacatggccatcgcccaggaggaccgctatccgatc
accgatatcctgcgccagaccccggacatcccggccaactgccagtgggcgatcttcctg
cgcaaccacgacgagctgaccctggagatggtcaccgacgacgagcgcgactatctctgg
aaccactatgccgccgaccgccgcgcgcgcctcaacctgggcatccgccggcgcctggca
ccactggtggagcgcgaccggcggcgcatcgagctgctgcacagcctgctgctgtcgatg
ccgggcacgccgaccctgtactacggcgacgagatcggcatgggcgacaacatttatctc
ggcgaccgcgatggcgtacgcacgccgatgcagtggtcggtggaccgcaacggtggcttt
tcccgcgccgacccggcgaagctggtgctgccgccgatcctcgacccgctgtacggctac
cagacgatcaacgtcgaggcgcaggcgcgcgacccgcattcgctgctcaactggatgcgc
cgcctgctggcggtgcgcagccagcagagggccttcggccgcggcagcctgaagatgctc
gcgccgagcaaccggcggatcctcgcctacctgcgcgaatacgccgagggcgaacgccgg
gacagcatcctctgcgtggccaacctgtcgcgcgcggcgcaggcggtggaactggacctg
gcggcgcacgccggcaaggtgccggtggaaatggtcggcggcatgtcgttcccgccgatc
ggcgagctgacctacctgctgaccctgccaccctacggcttctactggttctacctggcc
gacgcggcgcagatgccgagctggcacgtggccgcggacgagcgcctgccggaactgccg
accctggtggtcaagcagcgcctcggcgaactgttgcagggcgcctcgcgggacatcctg
gaaggcgagacgctgccggcctacctgccgaagcgccgctggttcgccggcgagaagggc
cagccgcggctctgctacatcgttccggtggacgaggcggagccgcgctgcgcgctgtgc
gaactcgagatcgacgggctgcgctaccagttgccactgggcttcctcgacgccgaccag
cgcggcgacagcctgccgcaactgctggccctggcgcggctgcggcgcggacgcaaggtc
ggcctgctgaccgacgccgccagcctgccgctgttcgcccgcagggtcctcgcgcaactc
cgcgccgaggcgctgatcgcccacggcgacggcgagatccagttcgtcccggcggtgggc
ctggcggagctggacgacatcgccgacgaggaggtcctgccattcgcggtggaacagtcc
aacagctcgatccgcttcggcgagcgcatggtcctcaaggtgctgcgcaagatccttccc
gggctgcacccggagatcgaggtcggcggctacctgacccgccacggctacccgggcatc
gccccgctgctcggcgaagtgcggcgggtcgacgccgcgggcgtgccgcataccctggcg
atcctgcagggttacctgagcaaccagggcgacgcctggaactggaccctggacaacctg
gagcgggccgtgcgcgacgagatctccggggccagcgaggcgctcgaggggcaatacgac
agcctcgccgaactgcgcggcttcgccgccaacctcggggcccggctcggtgaaatgcac
agcgtactggccggcgagtcggacgacccggccttcggcagccgcgagagcgacgacgcc
agcgtccaggcctgggcgctgcgcatcgccgagcagttgcgcgaggccgccgagcgcctg
ggcgagccgccgcggccgttgcagggcgaggcggcggaacaggcgcggcacctgctggaa
cgcctgccggcgctgctcgaacgcctgccgctgctggcccggcaggccgccggcgggctg
ctgatccgggtccacggcgacctgcacctgggccaggtgctgatggtccagggcgacgcg
cgcttcatcgacttcgaaggcgagccggcgcgcagcctggaagaacgccgccagcgccac
agcccgatgaaggacgtcggcggcatgctgcgctcgttcgactacgcggcggcgatggtc
ctgcgcaacgcgcagagcaccgacagctcggaacaggccgacagcgcccggcgcaaggtc
gccacgcgctatcgcggcgaggcccgcgacgccttcctggccggctaccgcgccgccgcg
gcgggcctcgcgcacgcctggcacggccgcgaaggcgagggcgcggcgctggccctggcc
tgcctggaaaaggccgcctacgaactgctctacgaagccgactaccgccccgactggctg
gaagtgccgctcgccggtctggccgaactcaccgaacacctcctgaagggcaagaaccga
tga

DBGET integrated database retrieval system