KEGG   Pseudomonas aeruginosa PA7: PSPA7_3173Help
Entry
PSPA7_3173        CDS       T00569                                 

Gene name
ligD
Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
pap03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pap00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    PSPA7_3173 (ligD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pap03400]
    PSPA7_3173 (ligD)
Enzymes [BR:pap01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PSPA7_3173 (ligD)
DNA repair and recombination proteins [BR:pap03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     PSPA7_3173 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ABR80822
UniProt: A6V648
LinkDB All DBs
Structure
PDB: 

Position
complement(3284226..3286769)
Genome map
AA seq 847 aa AA seqDB search
MPSKPLAEYARKRDFRQTPEPSGRKRRKDGDGLLRYCIQKHDASRLHYDFRLELDGTLKS
WAVPKGPCLDPAVKRLAVQVEDHPLDYADFEGSIPKGHYGAGDVIVWDRGAWTPLDDPRE
GLEKGHLSFLLDGEKLSGRWHLIRTNLRGKQPQWFLVKSKDDEARSLDRFDVLKERPDSV
LSERTLVPRRGEAATPAARPARRGKAGKAGKGGGKTPMPEWIAPELASLVEQPPHGQWAY
ELKLDGYRLMSRIEDGHVRLLTRNGHDWSERLPHLKKALAGLGLERSWLDGELVVLDEEG
RPDFQALQNAFEEGHGENILYFLFDLPYHEGEDLRDVALEERRARLEALLDGQDEDPLRF
SATLAENPRDLLASACRLGLEGVIGKRLGSVYRSRRSNDWIKLKCQLRQEFVIVGYTEPK
GSRRHIGALLLGLYSPDEERRLRYAGKVGTGFTAASLKKVHERLAPLAINSSPLAKVPPA
RETGVVQWVRPERLCEVSYAQMTRGGIIRQAVFHGLREDKPAREVTGERPAGPPPARGAR
KAGSASGASRAATAGVRISHPRRLIDPSIQASKLELAEFHARYADLLLRDLRERPVSLVR
GPDGIGGELFFQKHAARLKIPGIVQLDPALDPGHPPLLQIRSAEALVGAVQMGSIEFHTW
NASLANLERPDRFVLDLDPDPALPWKRMLEATQLSLTLLDELGLRAFLKTSGGKGMHLLV
PLERRHGWDEVKAFAQAISQHLARLMPERFSAVSGPRNRVGRIFVDYLRNSRGASTVAAY
SVRAREGLPVSVPVFREELDSLQGANQWNLRSLPQRLDELAGDDPWADYAGTRQRLSAAM
RRQLGRG
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atgcccagcaagccgctcgccgagtacgcgcgcaagcgcgatttccgccagaccccggag
cccagtgggcgcaagcgccgcaaggacggcgacggcctgctccgctattgcatccagaag
cacgacgccagccggctgcactacgatttccgcctggaactggacggcaccctgaagagc
tgggcggtgcccaagggaccatgcctcgacccggcggtgaaacggctcgcggtgcaggtg
gaggaccacccgctggactacgccgacttcgaaggcagcatacccaagggccactacggc
gccggcgacgtgatcgtctgggaccgtggcgcctggacgcctctagacgacccgcgcgaa
gggctggagaaaggtcatctcagcttcctcctcgacggcgagaaactctccgggcgctgg
cacctcatccgcaccaacctgcgcggcaagcagccccagtggttcctggtcaagtccaag
gacgacgaggcgcgcagcctggatcgcttcgatgtgctgaaggaacgtcccgacagcgtg
ctcagcgagcgcacgctggtgccccgccgcggcgaagccgccacgcccgcggccaggccc
gcgcgacgcggcaaggccggcaaagccggcaagggcggcgggaagacgccgatgcccgag
tggatcgcccccgaactggccagcctggtcgagcagccgccgcacgggcaatgggcctac
gagctcaagctggacggctaccggctgatgagccgcatcgaggacggccacgtgcgcctg
ctgacccgcaacggccacgactggagcgaacgcctgccgcacctgaagaaggccttggcc
gggctcggccttgagcgcagttggctggacggcgagctggtggtcctcgacgaggagggc
cggccggacttccaggccctgcagaacgccttcgaggagggccacggcgaaaacatcctg
tatttccttttcgacctgccgtatcacgaaggcgaggacctgcgcgatgtcgccctggaa
gagcgccgcgcgcgcctggaggcgctgctggacgggcaggacgaagaccccctgcggttc
tccgcgacgctcgcggaaaacccccgcgacctgctggccagcgcttgcaggctcggcctc
gaaggcgtgatcggcaagcgcctgggcagcgtctaccgctcgcgccgcagcaacgactgg
atcaagctcaagtgccagttgcgccaggagttcgtgatcgtcggctacaccgagccgaag
ggctctcgccggcacatcggcgccttgcttctcggcctctacagcccggacgaggaacgc
cggctgcgctacgccggcaaggtcggcaccggcttcaccgccgccagcctgaagaaggtc
catgagcgcctggcgcccctggcgatcaattccagcccgctggcgaaggtaccgccggcg
cgcgagaccggcgtggtgcagtgggtgcggccggaacgactgtgcgaggtttcctatgcg
cagatgacccgtggcgggatcatccgccaggcggtgttccacggtttgcgcgaagacaaa
ccggcgcgcgaggtgaccggcgaacgtccggccggcccgccgccggcgcgcggcgcgcgc
aaggccgggagcgcgagcggcgcctcgcgggcggccaccgccggggtacgcatcagccat
ccgcggcggctgatcgatccatcgatccaggccagcaagctggaactcgccgagttccat
gcgcgctacgccgacctgctcctgcgcgacctgcgcgagcgcccggtgtcgctggtccgc
ggccccgatggcatcggcggcgaactgttcttccagaagcacgcggcgcgcctgaagatc
cccggtatcgtccagctcgacccggcgctcgatcctggccatccgccgcttctgcagatc
cgcagcgccgaggcgctggtcggcgcggtgcagatgggcagcatcgaattccacacctgg
aacgccagcctggccaacctggagcggcccgaccgcttcgtcctcgatctcgatccggac
ccggcgctgccgtggaaacgcatgctcgaggcgacccaactgagcctcacgctgctcgac
gagctgggcctgcgtgccttcctcaagaccagcggcggcaagggcatgcacctgctggta
ccgctggagcgccggcatggctgggacgaggtgaaggctttcgcgcaggccatttcccag
cacctggcgcggctgatgccggagcgcttctcggcggtttccgggccgcgcaaccgggtc
ggcaggatcttcgtcgactacctgcgcaacagccgcggcgccagcaccgtggccgcctac
tcggtacgcgcccgcgaagggctgccggtgtcggtgccggtgttccgcgaggagctcgac
tcgctgcagggcgccaaccagtggaacctgcgcagcctgccgcagcgcctcgatgaactc
gccggcgacgatccctgggccgactatgccggcacccgccaacgcctcagcgccgccatg
cgccgccagctcggccgcggctga

DBGET integrated database retrieval system