KEGG   Pandoraea apista: SG18_00140Help
Entry
SG18_00140        CDS       T03588                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
papi  Pandoraea apista
Pathway
papi00440  Phosphonate and phosphinate metabolism
papi01100  Metabolic pathways
papi01120  Microbial metabolism in diverse environments
papi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:papi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    SG18_00140
Enzymes [BR:papi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     SG18_00140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL NTP_transferase IspD NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: AJE96983
UniProt: A0A0B5FB86
LinkDB All DBs
Position
complement(5552255..5553964)
Genome map
AA seq 569 aa AA seqDB search
MNAPDAFTLPPTATRASQLRAMLRSNQLEFLMEAHNGLSARIVREAGFKGIWASGLAISA
QFGVRDNNEASWTQVVDNLEFMADASNLPILLDGDTGYGNFNNMRRLVRKLEQRGVAGVC
IEDKVFPKTNSFIGGERQPLADIDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEA
LRRAEAYRQAGADAILIHSKLKRADEIVQFAREWDNRCPLVIVPTKYYSTPTDVFRDAGI
SVVIWANHLIRAATSAMQAVAAEIHRSETLINVEDRIATVDEIFRLQDADEYTEAEDRYL
SAANAPRSAIVLAASRGKNLESVTTDRPKVMLPVAGKPLLRWLVDSFKKQGVNDITVVGG
YRADAIDTAGITLAVNERHAETGELASLARVPNAFTHDTVVSYGDLLFRSYIVRDLIESD
ADFTVVVDSTAATTANAANASVRDFAYCSAGDDRGLFGQQVLLEKISANAADAGRSPNGR
WIGLLGVRGDEGRAQLQRVFAALQARPDFDQLGMPDLINALAADGARIEVQYVHGHWRGV
NDMEEFRRAADFAHGQTPFSGAAPETQGD
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctcccgacgcattcaccctcccgccgacggccacgcgcgcgtcgcaactgcgc
gccatgctgcgcagcaatcaactcgaattcctgatggaagcccacaacggcctgtccgca
cgtatcgtgcgcgaggccggcttcaagggtatctgggcctcgggccttgccatctcggcg
caattcggtgtgcgcgataacaacgaagccagttggacgcaggttgtcgataacctcgag
ttcatggccgacgccagcaatctgccgatcctgctcgacggcgacaccggctacggcaac
ttcaacaacatgcgacgcctcgtgcgcaagctcgagcaacgtggcgtggccggcgtgtgc
atcgaagacaaggtcttcccgaagaccaatagcttcatcggcggcgaacgccagccgctc
gcggacatcgacgagttctgcggcaagatcaaggccggcaaggactcgcaggccgacgac
gatttctcgatcgtggcgcgtgtcgaagcgctgatcgccggctggggcatggaagaagct
ctgcgccgggccgaggcctatcgtcaggccggcgccgacgccatcctgattcacagcaag
ctcaagcgtgccgacgaaatcgtgcaattcgctcgcgagtgggataaccgctgcccgctg
gtgatcgtgccgacgaagtactacagcacgccgaccgacgtgttccgcgacgcgggtatc
agtgtcgtgatctgggcaaaccatctgattcgcgccgccacatcggcgatgcaggccgtg
gccgccgagatccaccgcagcgagacactcatcaacgtcgaagaccgtatcgcgacggtc
gacgagatcttccgcctgcaagacgccgacgaatacaccgaagcggaagaccgttacctg
tcggccgcgaatgcaccgcggtcggccatcgtgctggccgccagtcgcggcaagaacctc
gagagcgtgacgaccgaccgcccgaaggtgatgttgccggtcgccggcaagccgctgctg
cgctggctggtcgacagcttcaagaaacagggcgtgaacgacatcacggtcgtgggtggc
tatcgcgccgacgccatcgacacggcgggcatcaccctcgcggtgaacgaacgtcacgcc
gaaaccggcgaactcgcctcgcttgcccgcgtgcccaacgccttcacgcacgacacggtc
gtctcttatggcgacctgctgttccgcagctacatcgtgcgtgatctgatcgagagcgac
gccgacttcacggtggtcgtcgactcaacggccgcgaccacggccaatgccgccaacgcc
agcgtgcgagactttgcgtactgctcggccggcgacgaccgcggtctgttcggccagcaa
gtgctgctcgagaagatcagtgccaacgccgcagacgccgggcgctcccccaacggccgc
tggattggcctgctgggcgtgcgaggcgacgaaggccgcgcacaactgcaacgcgtcttc
gcagcattgcaggctcgcccggacttcgaccagctcggcatgcccgatctgatcaatgcg
ctggccgccgacggcgcccggatcgaagtgcaatacgtgcacggccactggcgcggagtg
aacgacatggaagaattccgccgcgcggcggactttgcccatggtcagaccccattcagc
ggcgccgccccggagacacaaggtgattga

DBGET integrated database retrieval system