KEGG   Pandoraea apista: SG18_00590Help
Entry
SG18_00590        CDS       T03588                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
papi  Pandoraea apista
Pathway
papi00020  Citrate cycle (TCA cycle)
papi00480  Glutathione metabolism
papi01100  Metabolic pathways
papi01110  Biosynthesis of secondary metabolites
papi01120  Microbial metabolism in diverse environments
papi01130  Biosynthesis of antibiotics
papi01200  Carbon metabolism
papi01210  2-Oxocarboxylic acid metabolism
papi01230  Biosynthesis of amino acids
Module
papi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
papi_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:papi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SG18_00590
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SG18_00590
Enzymes [BR:papi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     SG18_00590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AJE97050
UniProt: A0A0B5F156
LinkDB All DBs
Position
2107011..2109251
Genome map
AA seq 746 aa AA seqDB search
MSTQQPSIIYTLTDEAPLLATGSFLPIIRTFTAPAGVSVETSDISVSGRILGEFPEFLTE
EQRVPDNLAELGRLTQDPNTNIIKLPNISASVFQLQSAIKELQSKGYKIPDYPEDPKTEE
EKAIQKRYSKCLGSAVNPVLREGNSDRRAPLAVKNYARKHPHSMGEWSMASRTHVAHMKH
GDFYHGEKSMTLDRARDVKMELVTKSGKTIVLKPKVSLLDGEIIDSMFMSKKALCDFYEE
QMEDARKTGVMFSLHVKATMMKVSHPIVFGHAVKIFYKEAFEKHGKLFDELGVNVNNGLV
NLYEKIESLPSSKREEIIRDLHACHEHRPELAMVDSAKGISNLHAPNDVIVDASMPAMIR
IGGKMWGADGRPKDTKAVIPESTFARIYQEIINFCKTNGAFDPTTMGTVPNVGLMAQKAE
EYGSHDKTFEIAEDGVANIVDIDTGEVLLSQNVEAGDIWRMCQVKDAPIRDWVKLAVNRV
RNSGMPAVFWLDPYRPHEAELIKKVEKYLKDYDTNGLDIQIMSQVRAMRYTLERVIRGLD
TISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVKQLVEEN
HLRWDSLGEFLALAVSLEDLGIKTGNERAKILAKTLDAATGKLLDNNKNPSPKTGELDNR
GSQFYLAMYWAQELAAQTDDADLAKTFAPLAKQLTENEKTIVGELADVQGKPTDIGGYYK
PDFEKLEQVMRPSKTFNAALASLAKA
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgcagcaacccagcatcatctacaccctgaccgacgaagcaccgcttctggcc
accggctctttcctcccgatcattcgcacgttcacggcaccggcgggcgtgtcggtcgag
acgagcgacatttccgtctcgggccgtatcctcggcgagttccccgaattcctgactgaa
gaacagcgcgtcccggataacctcgccgagctgggccgtctgacgcaagacccgaacacg
aacatcatcaagctgccgaacatcagcgcgtcggtgttccagctccagagcgccatcaag
gaactgcaatcgaagggctacaagatcccggattacccggaagatccgaagaccgaagaa
gagaaagccatccagaagcgctactcgaagtgcctgggctcggcagtgaacccggtgctg
cgcgaaggcaactcggatcgccgagcaccgctcgctgtcaagaactacgcccggaagcac
ccgcacagcatgggcgagtggagcatggcttcgcgcacgcacgtggcgcacatgaagcat
ggcgacttctaccacggcgaaaagtcgatgaccctcgaccgcgcccgtgacgtcaagatg
gaactcgtgacgaagagcggcaagacgatcgttctcaagccgaaggtctcgctgctcgac
ggcgaaatcatcgacagcatgttcatgagcaagaaggcgctgtgcgacttctatgaagaa
cagatggaagacgcgcgcaagactggcgtgatgttctcgctgcacgtgaaggccaccatg
atgaaggtctcgcacccgatcgtgttcggccacgctgtgaagatcttctacaaggaagcc
ttcgagaagcacggcaagctgttcgacgaactgggcgtgaacgtcaacaacggtctcgtg
aatctgtacgagaagatcgaatcgctgcccagctcgaagcgcgaagaaatcatccgcgat
ctgcacgcctgccacgagcaccgcccggaactggcgatggtcgactcggccaaggggatc
tcgaacctgcacgcaccgaacgacgtgatcgtcgacgcctcgatgccggccatgatccgt
atcggcggcaagatgtggggcgccgacggccgtccgaaggacacgaaggccgtgatcccg
gaaagcacgttcgctcgcatctatcaggaaatcatcaacttctgcaaaacgaacggcgcg
ttcgatccgaccacgatgggtacggtgccgaacgtgggcctgatggcgcagaaggcggaa
gagtacggctcgcacgacaagacgttcgaaatcgccgaagacggcgtggccaacatcgtc
gacatcgacacgggcgaagtgctgctctcgcagaacgtggaagccggcgacatctggcgt
atgtgccaggtcaaggacgcgccgatccgcgactgggtgaagctcgccgtgaaccgcgtg
cgcaactcgggcatgccggccgtgttctggctcgacccgtaccgtccgcacgaagccgaa
ctgatcaagaaggtcgaaaagtacctgaaggattacgacaccaacggcctcgacatccag
atcatgtcgcaagtgcgcgccatgcgttacacgcttgagcgcgtgatccgcggcttggac
accatctcggtgaccggtaacattctgcgcgactacctgaccgacctgttcccgatcatg
gaactgggcaccagcgccaagatgctgtcgatcgtgccgctcatggccggtggcggcatg
tacgaaacgggggctggcggttcggcgccgaagcacgtcaagcaactggtggaagagaac
cacctgcgctgggactcgctgggtgaattcctggcattggccgtgtcgctggaagacctg
ggcatcaagacgggtaacgaacgcgccaagattcttgccaagacgctcgacgctgccacc
ggcaagctgctcgacaacaacaagaacccgtcgccgaagaccggtgaactggacaatcgt
ggcagccagttctacctggcaatgtactgggcacaggaactggccgcgcaaacggacgac
gccgatctggcgaagacgtttgctccgctcgccaagcaactgaccgagaacgagaagacc
atcgtgggtgaactcgccgacgtgcagggcaaaccgacggacatcggcggctactacaag
cccgacttcgagaagcttgagcaagtcatgcgtccgagcaagacgttcaacgctgcgctg
gcaagccttgcgaaggcgtaa

DBGET integrated database retrieval system