KEGG   Pandoraea apista: SG18_04910
Entry
SG18_04910        CDS       T03588                                 

Definition
(GenBank) hypothetical protein
Organism
papi  Pandoraea apista
SSDB
Motif
Pfam: T2SSB DivIC Cytochrom_B562 Uso1_p115_C
Other DBs
NCBI-ProteinID: AJE97671
LinkDB
Position
complement(3046435..3047079)
AA seq 214 aa
MTIPQLPDENAGRARWLKITAAAWLLLVSILAVVNSVGLSRLSEQSQASAQDAHVQALNT
RVAELEQQAAASKNQPKPVTQPDFEAARKLLDERLAQVEHTQGADAHAGDLQALQARMGD
LEARMKRTAAPAAAPRRTAEPAKPKVPEPPFNVVGVELRGGERFLSVAAPKASSVLDVWL
LREGDAVGAWHLLAIEARAAVFRVDGQTQRLALP
NT seq 645 nt   +upstreamnt  +downstreamnt
atgaccatcccgcagcttcccgacgagaacgccggccgcgcgcgctggttgaagatcaca
gcggccgcatggctgctgctcgtgagcatcctggccgtggtcaacagcgtgggcctgtcg
cgcctgagcgagcaaagccaggccagcgcccaggatgcccacgtgcaggcgctcaacacg
cgcgtcgccgaactcgaacagcaggcggcggcctcgaagaaccagcccaagcccgtcacc
caacccgacttcgaggccgcccgcaagttgctggacgaacgcctggcacaggtggagcac
acccagggcgcagacgcccatgccggcgacttgcaggcgctgcaggcgcgcatgggcgac
ctcgaagctcgcatgaagcgaaccgccgcgcctgccgcggcaccccggcgcaccgccgag
ccggccaagcccaaggtgcccgaaccgccgttcaacgtcgtgggcgtggagctgcgcggc
ggcgagcgcttcctgtcggtggcggcacccaaggcgtcgtcggtgctggacgtgtggctg
ctgcgcgaaggcgatgccgtgggcgcgtggcatctgctggcgatcgaggcgcgcgccgcc
gtgttccgcgtggatggacagacccagcgcctcgcgctgccgtag

DBGET integrated database retrieval system