KEGG   Pandoraea apista: SG18_12275Help
Entry
SG18_12275        CDS       T03588                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
papi  Pandoraea apista
Brite
KEGG Orthology (KO) [BR:papi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SG18_12275
Enzymes [BR:papi01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     SG18_12275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_2 GST_N_3 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: AJE98772
UniProt: A0A231U2R0
LinkDB All DBs
Position
complement(4711264..4711983)
Genome map
AA seq 239 aa AA seqDB search
MSDQSVDLSQFPITRKWPAAHPDRLQLYSLPTPNGVKVSIMLEEIGLPYEVHLVSFQTDD
QRSPEFLSLNPNNKIPAILDPNGPGGKPLPLFESGAILWYLAEKTGKLLPADPAARYETL
QWVMFQMGGVGPMFGQLGFFHKFAGKDYEDKRPRDRYVEESKRLLGVLDSHLANRQWIMG
DEYTIADIATFPWIRNLVGFYEAGELVEFAQFRNVQRALAAFVARPAVIRGLDIPKRPA
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatcagtccgtcgatttgtcccagtttccgatcacgcgcaagtggcccgctgcg
caccccgaccggttgcaactgtattccctgcctacccccaacggcgtgaaggtatcgatc
atgctcgaggaaatcgggctgccgtacgaagtgcatctggtgagcttccagaccgacgat
caacgctcgcccgagtttctgtcgctcaaccccaacaacaagattcccgcgatcctcgat
ccgaacggccccggcggcaagccgctgccgctgttcgagtcgggcgcgattctctggtat
ctcgccgagaagaccggcaagctgctgcccgccgatccggccgcacgttatgaaacgctg
caatgggtcatgttccagatgggcggcgtgggcccgatgttcggtcagttgggcttcttc
cacaaattcgctggcaaggactacgaagacaaacgcccgcgtgatcgctatgtcgaggaa
tcgaagcgcctgctcggcgtactcgactcgcatctggcgaatcgccagtggatcatgggc
gacgaatacacgattgccgacatcgccaccttcccctggattcgaaacctcgtcgggttc
tacgaagcgggtgaactggtcgagttcgcgcagttccggaacgtgcaacgcgcacttgcg
gcgtttgtcgcgcgccccgcggtgattcgtggtctcgacattccgaagcgtcctgcctga

DBGET integrated database retrieval system