KEGG   Pandoraea apista: SG18_14095Help
Entry
SG18_14095        CDS       T03588                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
papi  Pandoraea apista
Brite
KEGG Orthology (KO) [BR:papi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SG18_14095
Enzymes [BR:papi01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SG18_14095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 DAO FAD_binding_2 Glutaredoxin HI0933_like NAD_binding_8 FAD_binding_3 FAD_oxidored Thi4 K_oxygenase DUF2190 FMO-like NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: AJE99036
UniProt: A0A5E5P8F4
LinkDB All DBs
Position
5097180..5098778
Genome map
AA seq 532 aa AA seqDB search
MLDANLKAQLQTYLQKVTRPIEIAVWLDDSPKAAEMKALVDEIAPLSPQIAVVVRNDPDQ
DAGERRPSFAIGTPGEAPRIRFAGLPMGHEFTSLVLALLQVGGHPVKLDDDTIAQIRALD
GDFRFETYISLSCQNCPEVVQALNVMALINPRIQQVTIDGALFQSEVEARQVMAVPTVFL
NGESFTQGRTSVKELLAKLDTGASARAAKALENKPVYDMLIVGGGPAGAAAAIYAARKGI
VTGVVAERFGGQVLDTMAIENFVSVTHTEGPKFATALEQHVKTYDVDVIDTQRAEALVPG
KIHEVHLASGAVLKARAVVLATGARWREIGVPGEREYRNRGVAYCPHCDGPLFKGKRVAV
VGGGNSGVEAAIDLAGIVKEVTLIEYGAQLRADEVLQRKLRSLPNVRVLTNAQTTEIHGD
AQKVNGLAYRDRVSGETATIALEGVFVQIGLVPNTEWLKDTVALSRHGEIEVDAKGKTSV
PGVFAAGDVTTVPFKQIVIAVGEGAKASLGAFEHLMLSSVEDEAATPEKIAA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgcgaacctcaaagcccagttgcaaacgtacctccagaaagtcacgcgcccg
atcgagatcgccgtgtggctcgatgacagtcccaaggcggccgaaatgaaggcgctggtg
gacgagatcgcgccgctctcgccgcagatcgctgtggtggtgcgaaacgaccccgatcag
gacgctggcgagcgccgtccgtcgtttgccatcggcacgccgggcgaggcgccgcgcatt
cgtttcgccggactgcccatgggccatgagttcacctcgctggtgctcgcgttgctgcaa
gtcggcggacatccggtcaagctcgacgacgacaccatcgcgcagattcgcgcgctcgac
ggggatttccgcttcgaaacctacatttcgctgtcgtgccagaactgcccggaagtcgtg
caggcgctgaacgtcatggcgctcatcaatccgcgcattcaacaagtcaccatcgacggc
gcactgttccagagtgaagtcgaggcgcgtcaggtcatggcggtgccgacggtatttctc
aacggcgagtcgtttacgcaaggccggaccagcgtgaaggagttgctcgcgaagctcgac
acgggagccagcgcacgggctgcgaaggcgctcgagaacaagcccgtctacgacatgctg
atcgtgggcggtggcccggcgggtgctgcggctgccatctatgcagcgcgcaagggcatt
gtgacgggcgtggtcgccgagcgtttcggcggtcaggtactcgacacgatggccatcgag
aatttcgtgtcggtgacacataccgaagggccgaagttcgccacggcgctcgaacagcac
gtcaagacctatgacgtcgatgtgatcgacacgcaacgcgccgaagccctggtgccgggc
aagatccacgaagtgcatctggccagcggcgctgtgctcaaggcgcgtgcggtggtgctg
gccaccggtgcgcgctggcgcgaaatcggggtgccgggcgagcgcgaatatcgcaaccgc
ggcgtggcgtactgcccgcactgcgacggcccgctgttcaagggcaagcgcgtcgcggtc
gttggcggtggcaattcgggcgtggaagccgccatcgatcttgccggcatcgtcaaggaa
gtcacattgatcgaatacggcgcgcaactgcgtgcagacgaagtgctccagcgcaagctg
cgcagcctgccgaacgtgcgtgtgttgacgaacgcgcaaacgaccgagattcatggcgat
gcccagaaggtcaacggccttgcctaccgcgaccgtgtgtctggcgagacggccacgatt
gccctcgaaggggtgttcgtgcagatcggtctggtgcccaacaccgaatggctcaaggac
acggtggcgctctcgcgtcacggcgagatcgaagtcgatgccaagggcaagacgtcggtg
ccgggcgtgttcgccgctggcgatgttacgacggtgccgttcaagcagatcgtcattgcc
gtgggcgaaggtgcgaaggcgtcgctgggcgcgttcgagcacctgatgctcagctcggtg
gaagacgaggcggcaacgccggagaagatcgccgcctga

DBGET integrated database retrieval system