KEGG   Pandoraea apista: SG18_17410Help
Entry
SG18_17410        CDS       T03588                                 

Gene name
hisZ
Definition
(GenBank) ATP phosphoribosyltransferase regulatory subunit
  KO
K02502  ATP phosphoribosyltransferase regulatory subunit
Organism
papi  Pandoraea apista
Pathway
papi00340  Histidine metabolism
papi01100  Metabolic pathways
papi01110  Biosynthesis of secondary metabolites
papi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:papi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    SG18_17410 (hisZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_His
Motif
Other DBs
NCBI-ProteinID: AJE99534
UniProt: A0A0B5F5L3
LinkDB All DBs
Position
493685..494845
Genome map
AA seq 386 aa AA seqDB search
MPNWLLPENIADVLPSEARKIEDLRRLMLDRFRTYGYELVMPPMLEYVESLLTGTGHDLD
LRTFKLVDQLSGRTMGLRADITPQIARIDAHLLNRKGVTRLCYAGSVLFTRPRNLLATRE
PFQIGAEIFGHSGLEADLEIQELLLYCLQLAGLKQIRIDLCHAGVLESLIERVPAAEAIE
SQLFGALATKDVPQLEALTRDLPTHLRDALLALTTLYGEPSETLARAREVLPDLPGVKAA
LDDLAYLAASQSKDGPAVLSIDLADLRGYQYHSGVMFAAYVDGIPNAIARGGRYDKVGQA
FGRDRPATGFSLDLRELAAISPVEARSNAILAPADDVPGLRAKIDSLRDAGEVVIRMLPG
HDQDFEEFTGDRVLVEKDGQWVVTPR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgccgaactggctacttcccgaaaatatcgccgacgtgctgccgtccgaggcgcgcaag
atcgaagatctgcgtcggctcatgctcgatcgtttccgcacctacgggtacgaactcgtg
atgccaccgatgctcgagtatgtcgagtcgctgctgaccggcaccggccacgacctcgat
ttgcgcacgttcaagctcgttgatcagctctcgggccgcacgatgggcctgcgcgccgac
attaccccgcagatcgcacgaatcgacgcccatttgctcaatcgcaagggggtgacgcgt
ttgtgttacgcggggagcgtgttgttcactcgtccgcgtaacctcctggcgacgcgcgag
ccgttccagatcggcgccgaaatcttcgggcatagcgggctggaagccgatctcgaaatc
caggagctactgctttactgcctgcaactcgcggggttgaagcagattcgtatcgatctg
tgccacgcgggtgttcttgaatcgctgatcgagcgtgtgccggccgccgaggccatcgaa
agtcagttgttcggggcgctcgcgaccaaggacgtaccgcagctcgaagcgttgacccgc
gatctgccgacgcatctgcgcgatgcgttgctggcgttgaccacgttgtatggtgaacct
tccgagacgctggcccgtgcccgcgaggtgctgcccgatctgcccggggtaaaggcggcg
ctggacgatctggcctatttggcggcgtcgcagagcaaggatggtccggcggtgttgtcc
atcgatctggccgatctgcgtggctatcagtatcacagtggcgtgatgttcgcggcatat
gtcgatggcattcccaatgccattgcccgtggcggccgttacgacaaggtggggcaggcg
tttggccgagatcgccctgcaaccggtttttcgctcgatttgcgtgagttggcggcaatt
tcgccggtagaagcgcgtagtaatgcgattttagcgcctgcggacgatgtccctggattg
cgtgccaaaatcgacagcctccgcgacgcgggcgaggtcgtcatccgcatgctgccgggc
cacgaccaggatttcgaggagttcacgggagatcgtgtccttgtcgagaaagacggtcag
tgggttgtgacaccccggtga

DBGET integrated database retrieval system