KEGG   Pandoraea apista: SG18_20220Help
Entry
SG18_20220        CDS       T03588                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
papi  Pandoraea apista
Pathway
papi00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:papi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SG18_20220
Enzymes [BR:papi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     SG18_20220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh RbcS LuxC
Motif
Other DBs
NCBI-ProteinID: AJE99942
UniProt: A0A0B5FIP9
LinkDB All DBs
Position
complement(1115244..1116698)
Genome map
AA seq 484 aa AA seqDB search
MTTVPTFLNYIDGEWCPSRSGATFDNRNPADTRDVIGHFQASGEADAQAAVRAAATAFTA
WKRLSTSARAKILLGAAAYLESHAARFGEELTREEGKQVALATDEFMRAAQTLRYYAVEA
QSYGGETFPNDDGDMTVYTVREPLGVVTVISPWNFPVSIPARKIAPALICGNTVVFKPAS
DAPLSGLRLTEAFVQAGIPRGVLNFVTGSASAVGPTLTGAREVRAISFTGSTTAGEQIHR
SASLSTRTQMELGGKNPLIVLDAKDIDRAVDLTVKGGFSLTGQACTGTSRVLVAREIRAA
FVERLAAKATALKIGNGLVPGMDLGPLATAGQLRTVLEYIEIGKREATWVCGGQQLTHDA
YAHGYFVTPAVFADVPRDARIAREEIFGPVIAVIDVDDYDDAIAVANDSDYGLAASLVTQ
DARLMHRFANDIEAGTVKINRTTTGNLVNAPFGGLKQSSTATFRESGRDGLEFYLQTKTV
YRGV
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccgttcccacgtttctgaattacatcgacggcgagtggtgcccgagccgatcg
ggcgcgactttcgacaaccgtaatccggccgatacgcgcgacgtaatcggccatttccag
gcttcgggcgaggctgacgcacaagctgccgtgcgcgcagccgcaacggcctttaccgcc
tggaagcgtctctcgacaagcgctcgcgcgaagattctgctgggtgccgccgcctacctg
gaaagccacgctgcgcgattcggcgaagaactcacgcgagaggagggcaagcaagtggcc
ctcgcaacggacgagttcatgcgtgccgcacagacacttcgctattacgcggtggaagcc
cagtcgtacggtggcgaaaccttcccgaacgacgacggcgacatgacggtatacaccgtg
cgtgaaccgctgggcgtggtgactgtcatttcgccgtggaatttccctgtctcgattccc
gcccgcaagattgctcccgcactgatctgtggcaataccgtggtgttcaaacccgcctcg
gacgcgcctttgagcgggctgcgcctgaccgaagcgtttgtgcaggccggcattcctcgg
ggcgtgctgaacttcgtgacgggaagcgcttcggcggtcggtcccacgttgactggcgcg
cgcgaagtgcgggcgatctcatttaccgggtcgacgactgccggtgagcaaatccatcgg
tcggcgtcgttgtcgacgcgcacgcaaatggaactcggcggtaaaaacccgctgatcgtg
ctcgacgcgaaagatatcgaccgcgcggtcgatctcaccgtcaaagggggattttcgctc
accgggcaagcgtgcaccggcaccagccgggtgctcgtcgcacgcgagattcgcgcggcc
tttgtcgaacgccttgctgcaaaggccaccgcgctcaagattggcaacggcctggtgccc
ggcatggacctcggcccgctcgccaccgcagggcaactacgcaccgtgctcgagtacatc
gagattggcaagcgagaagccacgtgggtctgcggcggccagcagctcacgcatgacgct
tacgcccatggctatttcgtcacgccggccgtgtttgccgatgtgccgcgcgacgcccgt
atcgcgcgagaggagatcttcggaccggtgatcgcggtgatcgatgtcgacgattacgac
gacgcaatcgccgttgcgaacgacagcgactacggcctcgcggcctcgctcgtcacgcag
gacgcgcgactgatgcaccgcttcgccaacgacatcgaggccggcacggtcaagatcaat
cgcacgaccaccggcaatctggtcaacgccccgttcggcggtctcaagcaatcgagcacg
gccaccttccgcgagtccggacgcgatggactcgagttctatttgcagacgaagaccgtc
tatcgcggcgtctga

DBGET integrated database retrieval system