KEGG   Pandoraea apista: SG18_22480Help
Entry
SG18_22480        CDS       T03588                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
papi  Pandoraea apista
Pathway
papi00020  Citrate cycle (TCA cycle)
papi00310  Lysine degradation
papi00380  Tryptophan metabolism
papi01100  Metabolic pathways
papi01110  Biosynthesis of secondary metabolites
papi01120  Microbial metabolism in diverse environments
papi01130  Biosynthesis of antibiotics
papi01200  Carbon metabolism
Module
papi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
papi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:papi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SG18_22480
  09105 Amino acid metabolism
   00310 Lysine degradation
    SG18_22480
   00380 Tryptophan metabolism
    SG18_22480
Enzymes [BR:papi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SG18_22480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 HlyD_3
Motif
Other DBs
NCBI-ProteinID: AJF00248
LinkDB All DBs
Position
complement(1640291..1641553)
Genome map
AA seq 420 aa AA seqDB search
MAIVEVKVPQFSESVSEGTLLDWKKKVGEAIAQDETVIEVETDKVVLEVPAPAAGVIVEV
TAGAGDTVTSEQIIAKIDTEAKAGAAAPVAAKPAEAAAPAAAAPAAAPAAGGASGGIASP
AAAKVLAEKNLSATDVAGSGRDGRVTKGDALAAGAKPAAAASSIPAPAQRAALPSVAASV
GRDTSLEGRPEQRVPMSRLRARIAERLLQSQQTNAILTTFNEVNMKPVMDLRNKYKDKFE
KEHGVKLGFMSFFVKAAVHALKKYPAVNASIDGNDIVYHGYFDIGIAVGSPRGLVVPILR
NADQMSLADIEKKIAEYGKKAADGKLSIEEMTGGTFSISNGGVFGSMLSTPIINPPQSAI
LGVHATKDRAVVENGEIVIRPMNYLAMSYDHRIIDGREAVLSLVAMKEALEDPARLLLDL
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggccattgttgaagtcaaagtcccccagttttccgagtcggtttccgaaggcacgctg
ctcgactggaagaagaaagtcggcgaagccatcgcccaagatgaaaccgtgatcgaagtc
gagaccgacaaggtcgtgctcgaagtgccggcgcccgccgccggcgtgatcgtcgaagtg
accgccggcgccggcgacaccgtgacgtcggaacaaatcatcgccaagatcgacaccgaa
gccaaggcaggcgctgctgcgccggtcgccgccaagccggcggaagccgctgcgccggcg
gcggctgccccggccgctgcgcccgcagcaggcggtgcttcgggtggcattgccagcccg
gccgcagccaaggtgctggccgagaagaacctgtcggcgaccgacgttgccggctcgggc
cgcgacggccgtgtgaccaagggcgacgccctggctgctggcgccaagccggctgccgcc
gcttcgtcgattcccgcaccggcacaacgtgctgcgctgccgtcggtggccgcttcggtg
ggccgcgacacgtcgctggaaggtcgtccggagcagcgcgtgccgatgtcgcgcctgcgc
gcacgtattgccgagcgcctgctgcaatcgcaacagaccaacgccattctgaccacgttc
aacgaggtcaacatgaagccggtgatggatctgcgcaacaagtacaaggacaagttcgag
aaggaacacggcgtgaagctgggtttcatgtcgttcttcgtcaaggccgctgtccacgcg
ctcaagaagtacccggccgtgaacgcctcgatcgacggtaacgacatcgtctaccacggc
tacttcgacatcggtatcgctgtcggctcgccgcgtggtctggtggtgccgattctgcgc
aatgccgaccagatgagcctggccgacatcgagaagaagatcgccgaatacggcaagaag
gctgccgacggcaagctgtcgatcgaagaaatgaccggcggcacgttctcgatctcgaat
ggcggtgtgttcggctcgatgctgtcgaccccgatcatcaacccgccgcaatcggccatt
ctgggcgtgcacgccacgaaggaccgcgctgtggtggagaacggcgagatcgtcatccgc
ccgatgaactacctggccatgagctacgaccaccgtatcatcgacggtcgcgaagccgtg
ctgagcctcgtcgccatgaaggaagcgctggaagatccggcgcgcctgctgctcgacctg
taa

DBGET integrated database retrieval system