KEGG   Pandoraea apista: SG18_24615Help
Entry
SG18_24615        CDS       T03588                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
papi  Pandoraea apista
Pathway
papi00620  Pyruvate metabolism
papi00680  Methane metabolism
papi01100  Metabolic pathways
papi01120  Microbial metabolism in diverse environments
papi01200  Carbon metabolism
Module
papi_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:papi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SG18_24615
  Energy metabolism
   00680 Methane metabolism
    SG18_24615
Enzymes [BR:papi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SG18_24615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AJF01332
LinkDB All DBs
Position
complement(5370842..5373703)
Genome map
AA seq 953 aa AA seqDB search
MPARSTAPKTRRSREDKDAPLREDIRFLGRLLGDVLREQQGSAAFDLVETIRQNAVRFHR
EGDRSAARALDTMLGGLTNEQAIQVVRAFSYFSHLANIAEDRHHNRRRRVHALAGSRAQP
GSLSAALQSLKDAGRADPATLQAFFASALIVPVLTAHPTEVQRKSILDAEREIARLLAHR
DDALTERESSRNTESMRAYVTTLWQTRMLRSSRLTVADEIDNALSYYRSTFLTEIPALYD
DVSAELHDAVPGVRAEGLGRFLQMGSWIGGDRDGNPNVTAQTLQLAITRQATEIFAHYLE
EVHLLGAELSVSQLLAGASDALLTLARRSPDDSPHRTDEPYRRALIGVYARLAATAREWV
GHVPHRGAVGDARPYLDASEFISDLNTVVASLMAHHGGALVSQRLGPLVRAAEVFGFHLA
SIDLRQSSDVHEAVIAELFAKAGVEANYAKLDEDAKLALLLRELSEPRALFSPYLDYSQR
TRDELAVFATARDIRARFGPRAVRNYIISHTETVSDLVEVMLLQKETGLFQGALGSGSAK
AIEPKVGAMVIPLFETIADLRNAPVIMREFFDIPGMSAVVTQQGGEQEVMLGYSDSNKDG
GFLTSNWELYKAELALVRLFEEKGIRLRLFHGRGGTVGRGGGPTYQAILSQPPGTVKGQI
RLTEQGEIIASKFANPEIGRRNLETIVAATLEATLLPSRNQPPRLAAYEKVMQTLSDTAF
AAYRNLVYETPGFTDYFFSATPIAEIAELNIGSRPASRKFSDPKNRRIEDLRAIPWGFSW
GQCRLLITGWYGFGSAVSAYLDGEGEDGKGKDGDAGREKRLDTLRQMVKRWPFFANLLSN
MDMVLAKTDLAVASRYAELVADEKLRKRVFDRIVSEWQSTSQALALITGHEERLADNPLL
ARSIKNRFPYLDPLNHLQVELLRRHRAGESDERARRGIHLSINGIAAGLRNTG
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
gtgccggccagatccactgcgcccaagactcgccgctcgcgcgaggacaaagacgccccg
ctgcgcgaggacatacgctttctcggccgcctgctcggcgacgtgctgcgcgaacaacaa
ggcagtgcagccttcgatctggtcgagaccattcgtcagaatgccgtgcgctttcaccgc
gaaggcgaccgcagcgccgcccgcgcgctcgacacgatgctgggcggtctgaccaacgag
caagccattcaggtggtgcgtgcgttcagctacttctcgcatctggccaatatcgccgag
gaccgccaccataaccggcgtcgccgcgtgcacgcgctggcgggcagccgcgcccagccg
ggcagcctgagcgccgccctgcaaagcctgaaagatgccggacgcgccgatcccgccacg
ctgcaggcgtttttcgccagcgccctgatcgtgcccgtgctcaccgcacatccgaccgaa
gttcagcgaaagagtattctcgacgccgaacgcgaaatcgcgcgtctgctggcgcatcgc
gacgacgccctcaccgagcgtgagtcgtcgcgcaacaccgaatcgatgcgtgcttacgtc
accacgctttggcagacccgcatgctgcgtagctcacgactgacggtggccgacgaaatc
gacaacgcgctgtcgtattaccgcagcacgttcctcaccgaaatccccgcgctgtacgac
gatgtgagcgcagaactgcacgacgccgtgccgggcgtacgcgccgagggcctcggacga
ttcctgcaaatgggcagttggatcggcggagatcgcgacggcaatccgaacgtcacggcg
caaacgctgcaactcgcgatcacgcgtcaggccaccgagatctttgcgcattacctcgaa
gaggtgcacttgctgggcgcggaattgtccgtctcgcaattgctcgccggggcaagcgac
gcactgctcacgctcgcgcgccgctcacccgacgactcgccgcaccgcaccgacgagccg
tatcgacgcgcgctcatcggcgtgtacgcacgcctggctgccacagcacgcgagtgggtc
ggccacgtgccgcaccgcggcgccgtcggcgacgcccggccgtacctcgacgccagcgaa
ttcatctcggacctgaacacggtcgtcgcctcgctgatggcacatcatggcggcgcgctg
gtctcccagcgactcggcccgctcgtgcgcgccgcggaagtgttcggcttccatctggcg
agtatcgatctgcgccagagttcggacgttcacgaagccgtcatcgccgaattgttcgcc
aaggcgggcgtagaagcgaattacgcaaaactcgacgaagacgcaaagctcgctttgttg
ctacgcgagctaagtgagccgcgtgcgctcttctcgccgtatctcgactattctcagcgc
actcgcgacgagttggccgtgttcgctaccgcgcgcgacattcgcgcacgcttcggccct
cgtgcggtacgcaactacatcatctcgcatacggaaaccgtgagcgatctggtggaagtc
atgctgctgcaaaaggagactggcctctttcagggcgcgctcggcagcggcagcgcgaag
gccatcgagcccaaagtcggcgccatggtcattccgctcttcgagacgattgccgacttg
cgcaacgcgccggtcatcatgcgagagttcttcgacattcccggcatgtccgctgtggtg
acccagcaaggcggcgagcaggaagtcatgctcggctactccgacagcaataaggatggc
ggttttctcacgtcgaactgggaactctacaaggcggaactggcactggttcgcctgttc
gaggagaaaggcattcgcctgcggctgttccacggccggggcggcaccgtgggccgtggc
ggcggcccgacctatcaggccatcctgtcgcagccgccgggcacggtgaaggggcagatt
cgcctcacggagcaaggcgagatcattgcgagcaagttcgccaacccggagatcgggcgg
cgcaacctggagacgatcgtggccgccacgctcgaagcaacgctgctgccgagccgcaac
cagccgccgcgtctggcggcatacgagaaggtcatgcagaccctctccgacacagccttc
gccgcctatcgcaacctcgtctacgagacgccgggcttcaccgactacttcttctcggca
acgccgatcgcggaaatcgccgagctgaacatcggctcacgccctgcctcgcgcaaattt
tccgatccgaagaaccgccgtatcgaggatttgcgcgccatcccgtgggggttctcgtgg
ggccagtgccgtttgctgatcacgggctggtatggcttcggcagcgcagtcagcgcgtat
ctcgacggcgaaggggaggacggcaagggcaaggacggcgacgcgggccgcgagaagcgt
ctcgacacgttgcgtcagatggtcaaacgctggccgttcttcgcgaacctgctctcgaac
atggatatggtgctcgccaagaccgatctggccgtggcctcacgctatgccgaactggtt
gcggacgagaagctgcgcaaacgcgttttcgatcgcatcgtgagtgagtggcaaagcacg
tcgcaggcgctcgccctcatcaccggtcatgaagaacgccttgcggacaatccgttgctt
gcccgctcgatcaagaaccgcttcccgtatctcgatccgctcaaccacttgcaggtcgag
ttgttgcggcgccatcgggcaggcgagtccgacgagcgtgcgcggcgaggcattcatctg
tccatcaacggcattgcagcgggtctgcgcaacacgggctga

DBGET integrated database retrieval system