KEGG   Pantoea ananatis PA13: PAGR_g0338Help
Entry
PAGR_g0338        CDS       T01970                                 

Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase GlpD
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
paq  Pantoea ananatis PA13
Pathway
paq00564  Glycerophospholipid metabolism
paq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:paq00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PAGR_g0338
Enzymes [BR:paq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     PAGR_g0338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 NAD_binding_8 3HCDH_N Lycopene_cycl FAD_oxidored GIDA
Motif
Other DBs
NCBI-ProteinID: AER30877
LinkDB All DBs
Position
complement(383736..385241)
Genome map
AA seq 501 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEARDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRTGLFMYDHLGKRTSLPGS
KSLSFGAESALKPEIKRGFEYSDCWVDDARMVVLNAQEVVKHGGEVRTRTRVTRAWRENG
LWMVEAEDIDSGKTFTWQAKGLVNAAGPWVKQFFDDGLELKSPYGIRLIKGSHIVVPRVH
NEKQAYILQNEDNRIVFVIPWMDEFSIIGTTDVEYKGDPKSVAIDDNEIDYILKVYNGHF
KKQLTPDDIVWTYSGVRPLCDDESDSPQAITRDYTLDVRDDNGQTPLLSVFGGKLTTYRK
LAEHALEKLSKYYPDAGAAWTKNCVLPGGNISGSSDDYAASLRRRYPFITENMARHYART
YGSSTEVLLKDATSLEDLGENFGHEFYEAELRYLVQHEWVREVDDAIWRRTKQGMWLNEA
QQARIAEWLAAKAKPTLSLAS
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagacctgatcgttatcggcggcggcatcaacggtgctggcatcgcagca
gacgctgcaggacgcggactgtcggtgttaatgctagaggcgcgggacctggcttgcgcg
acctcttccgccagctcaaagctgattcacggtggcctgcgctaccttgaacattatgaa
ttccgtctggtgagcgaagcgctggccgagcgcgaagtgctgttaaagatggcaccccat
atcgcgttcccaatgcgctttcgcttaccacaccgcccgcatctgcgtccggcgtggatg
atccgtaccggtctgtttatgtacgatcacttgggcaagcgcacgagtctgccgggcagt
aaaagcctgagctttggtgcagagtctgcacttaagcctgaaattaagcgcggttttgag
tattccgactgctgggtggacgatgcccgaatggtggtactcaatgcgcaggaagtggtt
aaacatggtggtgaggtgcgtacccgcactcgcgtgactcgcgcatggcgtgagaacggc
ctgtggatggtagaagctgaggatatcgacagcggcaaaaccttcacctggcaggccaaa
ggcctggtcaacgccgccggtccatgggttaagcagttcttcgacgatggcctggagctg
aaatcgccttacggtattcgcctgatcaaaggcagccatattgtggtgccgcgcgttcac
aatgagaagcaggcttatatcctgcaaaacgaagataaccgtattgtgtttgtcattccg
tggatggatgagttttctatcatcggcaccaccgacgtggaatacaaaggcgatccgaaa
agcgtcgctattgatgataatgaaatcgactacatcctgaaggtgtacaacggccatttc
aaaaagcagctgacgcctgacgacattgtgtggacctattccggcgtgcgtccgctttgt
gatgacgagtccgattcgccgcaggcgatcactcgcgattacaccctggatgtccgcgat
gacaacggtcagacaccgctgctgtccgtttttggtggcaaattgacgacttaccgtaag
ctggccgagcatgcgctggagaagctgtcgaagtattatcctgatgcgggcgcagcatgg
actaaaaactgcgtgctgcccggcggtaatatttccggcagcagcgacgattacgctgcc
agcctgcgccgccgttacccgttcattactgaaaacatggcacgtcactacgcccgcact
tacggtagcagcaccgaagtgctgcttaaagacgcgacatcgctggaagacctgggtgaa
aacttcggtcatgagttttatgaggcggagttacgttatcttgtgcagcatgagtgggtg
cgtgaagtggatgatgctatctggcgccgtaccaagcaaggtatgtggctgaacgaagcc
cagcaggcacgcattgccgaatggctggcggctaaggcgaagcctacgctgtcgctggca
tcgtag

DBGET integrated database retrieval system