KEGG   Pantoea ananatis PA13: PAGR_g0366Help
Entry
PAGR_g0366        CDS       T01970                                 

Definition
(GenBank) shikimater kinase I AroK
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
paq  Pantoea ananatis PA13
Pathway
paq00400  Phenylalanine, tyrosine and tryptophan biosynthesis
paq01100  Metabolic pathways
paq01110  Biosynthesis of secondary metabolites
paq01130  Biosynthesis of antibiotics
paq01230  Biosynthesis of amino acids
Module
paq_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:paq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PAGR_g0366
Enzymes [BR:paq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     PAGR_g0366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin dNK Cytidylate_kin2 AAA AAA_16 AAA_22 TsaE ABC_tran APS_kinase AAA_5 AAA_7 AAA_25 AAA_17 Ploopntkinase3 AAA_24 RNA_helicase AAA_PrkA AAA_28 AAA_29 His_biosynth RsgA_GTPase Mg_chelatase AAA_14 IstB_IS21 AAA_2
Motif
Other DBs
NCBI-ProteinID: AER30905
LinkDB All DBs
Position
416133..416654
Genome map
AA seq 173 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFFDSDQEIERRTGADVGWVFDVEGEAGFR
DREEKIINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLETTIEKQLARTQRDKKR
PLLQVESPPREVLEALAGERNPLYEEIADVTIRTDDQSAKVVANQIIHMLEKS
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaacgcaatatctttctggttgggccgatgggtgccggcaaaagcactatt
ggccgtcagttggctcagcaactcaatatggagttcttcgattccgatcaggaaattgag
cgacgcaccggagcggatgtgggctgggtttttgacgttgaaggcgaagctggcttccgc
gatcgtgaagaaaaaatcatcaatgaactgaccgagaagcagggcatcgtcctggcgacc
ggcggtggctccgtaaaatcccgggaaacacgtaatcgtctctccgctcgcggcgtcgtg
gtgtatcttgaaaccactattgagaaacaactggcacgtacacagcgtgataaaaaacgc
cccttactgcaggtagaatcaccgccgcgtgaagtgcttgaagcgctggcaggtgaacgt
aacccgctttatgaagagatcgccgacgtcactatccgcactgacgatcaaagtgcaaaa
gtggtggcgaatcagattatccacatgttggaaaaaagttga

DBGET integrated database retrieval system