KEGG   Pantoea ananatis PA13: PAGR_g2235Help
Entry
PAGR_g2235        CDS       T01970                                 

Definition
(GenBank) xylose isomerase XylA
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
paq  Pantoea ananatis PA13
Pathway
paq00040  Pentose and glucuronate interconversions
paq00051  Fructose and mannose metabolism
paq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PAGR_g2235
   00051 Fructose and mannose metabolism
    PAGR_g2235
Enzymes [BR:paq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     PAGR_g2235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AER32745
LinkDB All DBs
Position
complement(2425774..2426754)
Genome map
AA seq 326 aa AA seqDB search
MSDLKFATRLNSFASGAHLYWPDLQGKPSVLQMVARAGKVKGLTHLDLNYPQHLTSDSKT
LRQAIEDAGLAVNGMQMRWDAPQFKIGAFTHPDPKIRREAIDLTKRGIDTGREFGSRLMT
LWMGQDGFDYCFQVDYKKIWEDAVSAVREIADYAPDVDVSIEYKPNEPRAYSIFPNVTTC
LLAVEEAGSPNLGITLDFAHVLFANEIPAWAAAMVARRSRLLGLDLNDGWGKRDDGLMAA
SVNPRATLEFLWQMQRDGYQGAYYFDTFPDASGLDPVREAETNIATVTRLLKLCDQLNDN
PALAAAISRQDAVASQQIVNDIMLAR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatttaaagtttgctactcgtcttaactcctttgcttcgggggcacatctctac
tggccagatttgcagggcaagccctctgtactgcaaatggtggcgcgcgcaggcaaggtt
aaaggcttaacgcatttggatctcaactatccccagcacctcaccagtgacagtaaaacg
ctgcgccaggctattgaggatgccgggctggcggtcaacggcatgcagatgcggtgggat
gcaccgcagttcaaaattggcgcatttacccatccggatccaaaaattcgccgtgaggcg
attgacctgaccaagcggggaatcgataccggacgggaatttggctcccgcttaatgacg
ttatggatgggtcaggacggtttcgactactgcttccaggtcgattacaaaaaaatctgg
gaagacgccgtcagcgcggtgcgtgaaatcgccgactacgcgccggacgtggatgtgagc
attgaatacaaacccaacgagccgcgtgcctacagcatttttcccaacgtgaccacctgc
ctgctggccgtcgaagaggccggaagcccgaacctcggcatcacgctggattttgcccat
gtcctgttcgccaatgaaattcctgcctgggcggcggccatggtggcgcgtcgttcccgg
ctgctggggctggatttaaacgacggctggggcaaacgtgacgacggactgatggcggca
tcggttaatccgcgcgccacgttggagtttctgtggcagatgcagcgtgatggatatcag
ggcgcctactattttgacaccttcccggatgccagcggactggatccggtacgtgaagcc
gaaaccaacattgccaccgtgacgcgattactcaagctttgcgaccagcttaatgataat
ccggcgctggcagcggcgatcagccgtcaggatgcggtcgcctcacagcaaatcgtcaac
gacattatgctggcgcgttaa

DBGET integrated database retrieval system