KEGG   Pantoea ananatis PA13: PAGR_g2985Help
Entry
PAGR_g2985        CDS       T01970                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur protein SdhB
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
paq  Pantoea ananatis PA13
Pathway
paq00020  Citrate cycle (TCA cycle)
paq00190  Oxidative phosphorylation
paq00650  Butanoate metabolism
paq01100  Metabolic pathways
paq01110  Biosynthesis of secondary metabolites
paq01120  Microbial metabolism in diverse environments
paq01130  Biosynthesis of antibiotics
paq01200  Carbon metabolism
Module
paq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
paq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
paq_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:paq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PAGR_g2985
   00650 Butanoate metabolism
    PAGR_g2985
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PAGR_g2985
Enzymes [BR:paq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PAGR_g2985
    1.3.5.4  fumarate reductase (quinol)
     PAGR_g2985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4
Motif
Other DBs
NCBI-ProteinID: AER33481
LinkDB All DBs
Position
complement(3237424..3238140)
Genome map
AA seq 238 aa AA seqDB search
MRLEFSIYRYNPDVDDKPRMQDYTLEAEDGRDMMLLDALIRLKEKDPTLAFRRSCREGVC
GSDGLNMNGKNGLACITPVSALGNGKQKIVIRPLPGLPVVRDLVVDMGQFYAQYEKIKPF
LLNNGENPPAREHLQSPGEREHLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYR
FLIDSRDTETDARLDNLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRSA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgagacttgaattttcgatctatcgttacaacccggacgtcgatgacaaaccgcgcatg
caggactataccctggaagcggaagacggccgtgacatgatgctgctggatgcgctgatc
cgtctgaaagagaaggatcctaccctggcgtttcgtcgctcatgccgtgaaggcgtgtgc
ggttcagacggcctgaacatgaacgggaaaaacggcctggcctgcatcacgccggtctcg
gcgttaggcaacggcaagcagaaaatcgttatccgtcctctaccgggcctgccggtcgtg
cgcgacctggtggtggacatgggccagttttatgcccagtatgagaaaattaagcctttc
ttattgaataacggtgaaaacccgccagcgcgtgagcatctgcagtcgccgggcgagcgt
gagcatctggacggattgtatgagtgtattctctgcgcctgttgctcaacctcttgcccg
tcgttctggtggaacccggacaagtttattggtcctgcaggcctgctggccgcttaccgc
ttcctgattgacagccgtgatacggaaacggatgcgcgtctggataatctgagcgatgca
ttcagcgttttccgctgtcacagcatcatgaactgtgtaagtgtttgtcctaaagggcta
aacccgacgcgtgctatcggccacattaagtcgatgctgctgcaacgcagcgcgtag

DBGET integrated database retrieval system