KEGG   Pantoea ananatis PA13: PAGR_g2986Help
Entry
PAGR_g2986        CDS       T01970                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit SdhA
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
paq  Pantoea ananatis PA13
Pathway
paq00020  Citrate cycle (TCA cycle)
paq00190  Oxidative phosphorylation
paq00650  Butanoate metabolism
paq01100  Metabolic pathways
paq01110  Biosynthesis of secondary metabolites
paq01120  Microbial metabolism in diverse environments
paq01130  Biosynthesis of antibiotics
paq01200  Carbon metabolism
Module
paq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
paq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
paq_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:paq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PAGR_g2986
   00650 Butanoate metabolism
    PAGR_g2986
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PAGR_g2986
Enzymes [BR:paq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PAGR_g2986
    1.3.5.4  fumarate reductase (quinol)
     PAGR_g2986
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like Thi4 DAO
Motif
Other DBs
NCBI-ProteinID: AER33482
LinkDB All DBs
Position
complement(3238155..3239921)
Genome map
AA seq 588 aa AA seqDB search
MSLPVREFDAVVIGAGGAGMRAALQISQSGQTCALLSKVFPTRSHTVSAQGGITVALGNT
HDDNWEWHMYDTVKGSDYIGDQDAIEYMCHVGPEAILELEHMGLPFSRLDDGRVYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHTLYQQNLKNKTTIFSEWYALDLVKNDDGAIVGC
TAICMETGETVYFKAKATILATGGAGRIYQSTTNAHINTGDGVGMALRAGVPVQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAKDLAGRDVVARSMMVEIREG
RGCDGPWGPHIKLKLDHLGAEVLESRLPGILELSRTFAHVDPIKEPIPVIPTCHYMMGGV
PTKVTGQALRVNEQGEDEVIPGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGVHLL
ECLEEQGELREASQENIDAAMARFNRWENNTTGEDPVEIRKALQRCMQNNFSVFREGDAM
REGLAELKEIRERLKSARLDDRSPDFNTQRIECLELDNLMETAYATAVAANYRTESRGAH
SRFDYPERDDANWLCHSLYVPQTESMTRREVNMQPKLRAAFPPKARTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgagtttaccagtaagagaatttgatgccgtggtgatcggcgcaggcggcgcgggtatg
cgcgcggcgttgcaaatctcccagtcgggccagacctgtgccctgttgtccaaagtcttc
ccgacccgttcccatacggtctccgcgcagggcggaatcaccgttgcgctgggtaacacc
catgacgataactgggaatggcatatgtatgacaccgtcaaaggttccgactacatcggt
gaccaggacgcgattgaatacatgtgtcacgtcggtccggaagcgattctggaactggag
cacatgggcttgcccttctcccgtcttgatgacggccgcgtttatcagcgtccgtttggt
ggtcagtcgaaaaacttcggcggtgagcaggcggcgcgtactgccgcagcggccgaccgt
accggccacgcactgctgcatacgctgtaccagcagaacctgaaaaataaaaccactatc
ttctccgaatggtatgcactggatctggtcaaaaatgacgacggtgccatcgtaggctgt
acggcaatctgcatggaaaccggcgaaacggtttacttcaaagccaaggccaccattctg
gcgacgggcggtgcaggacgtatttatcagtccacgacgaacgcccacatcaataccggc
gacggtgttggcatggcgctgcgcgcgggcgtgcctgtgcaggatatggaaatgtggcag
ttccacccaaccggtatcgccggtgctggtgtactggtcaccgaaggctgtcgtggtgaa
ggcggttatctgctgaacaaacacggtgagcgtttcatggagcgctatgcgcctaacgcc
aaagaccttgccggtcgtgacgttgtggcccgttcgatgatggtggaaatccgtgaaggt
cgcggttgcgacggtccatggggcccgcacatcaagcttaaactcgatcacctgggtgcg
gaagtgctggaatcgcgcctgccgggcatccttgagctgtcccgtacctttgctcacgtt
gacccgattaaagagccgattccggttatcccaacctgtcactacatgatgggcggcgtg
ccaaccaaagtcaccggtcaggcgctgcgtgtgaatgagcagggcgaagacgaagtgatt
cctggcctgttcgcggtgggtgaaatcgcctgcgtatcggtacacggggcgaaccgtctg
ggtggcaactcgctgctggacctggtggtcttcggtcgcgcggctggcgtgcatctgctt
gaatgtctggaagagcagggtgaactgcgtgaagccagccaggaaaacattgatgccgcg
atggcgcgtttcaaccgctgggaaaataacaccacgggtgaagatccggttgaaatccgc
aaggcgttgcaacgctgcatgcagaacaacttctcggtattccgtgaaggcgatgcgatg
cgtgaagggcttgctgaactgaaagagatccgtgagcgtctgaagtccgcgcgcctggat
gaccgctcacctgacttcaatacacagcgtattgagtgccttgagctggataacctgatg
gaaaccgcttatgccaccgcagtggcggccaactaccgcactgagagccgtggcgcacac
agccgcttcgactatccggaacgtgatgatgccaactggctgtgccatagcctctatgtt
ccgcaaacggaaagcatgacgcgccgtgaggtgaacatgcaaccgaaactgcgtgcggcc
ttcccgccgaaagcgcgtacctactaa

DBGET integrated database retrieval system