KEGG   Psychrobacter arcticus: Psyc_1763Help
Entry
Psyc_1763         CDS       T00256                                 

Gene name
mdh
Definition
(GenBank) malate dehydrogenase (NAD)
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
par  Psychrobacter arcticus
Pathway
par00020  Citrate cycle (TCA cycle)
par00270  Cysteine and methionine metabolism
par00620  Pyruvate metabolism
par00630  Glyoxylate and dicarboxylate metabolism
par00680  Methane metabolism
par01100  Metabolic pathways
par01110  Biosynthesis of secondary metabolites
par01120  Microbial metabolism in diverse environments
par01130  Biosynthesis of antibiotics
par01200  Carbon metabolism
Module
par_M00009  Citrate cycle (TCA cycle, Krebs cycle)
par_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
par_M00012  Glyoxylate cycle
par_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:par00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Psyc_1763 (mdh)
   00620 Pyruvate metabolism
    Psyc_1763 (mdh)
   00630 Glyoxylate and dicarboxylate metabolism
    Psyc_1763 (mdh)
  09102 Energy metabolism
   00680 Methane metabolism
    Psyc_1763 (mdh)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Psyc_1763 (mdh)
Enzymes [BR:par01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     Psyc_1763 (mdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C
Motif
Other DBs
NCBI-ProteinID: AAZ19611
UniProt: Q4FQU7
LinkDB All DBs
Position
complement(2170547..2171536)
Genome map
AA seq 329 aa AA seqDB search
MSMKQPVRVAVTGAAGNISYAMLFRIASGEMLGKDQPVILQLLEIAPALDALKGVVMELE
DCAFPLLAGIVQTDDATVAFKDVDYALLVGSRPRGPGMERKDLLEANAAIFSAQGKALND
VASRDVKVLVVGNPANTNALIAQRNAPDLDPRNFTAMTRLDHNRAMAQLAGKTDSTVNDV
KKMIIWGNHSSTQYPDLTASTVNGKLALDLVDRTWYEGTYIPEVQQRGAAIIKARGASSA
ASAANAAIAHMRTWVLGTDENDWVSMGVYSNGEYGIAKGLIYSFPCTCTNGDWSIVDGVD
VSSAFSKEKMAATEQELSEERDAVAHLLP
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatgaaacagcctgtgcgcgttgccgtgactggtgccgctggtaatatcagctat
gctatgttatttcgtattgcttctggtgaaatgctaggtaaagatcagccagtgattctg
caattacttgaaatcgctccagcactcgacgccctaaagggtgtggtcatggaattagaa
gactgtgcattcccattattggctggaatcgtccaaactgatgatgcgaccgtggctttt
aaagatgtcgattacgcattacttgtaggctcacgccctcgtggtcctggtatggaacgt
aaagatttgctagaagccaacgctgcgattttctcagcacaaggtaaagcattgaatgat
gttgcaagccgtgatgttaaagtattggttgtaggtaaccctgcgaacactaatgcgcta
atcgcacagcgtaacgcaccagatcttgacccacgtaactttactgctatgactcgctta
gaccataaccgtgcaatggcacagttggctggcaagactgatagcacggttaatgacgtg
aagaaaatgatcatctggggcaaccattcatcaactcagtatcctgatttgacggcgagc
actgtaaacggtaagcttgcgttagatttggttgatcgtacgtggtatgaaggtacttat
atcccagaagtacaacaacgtggtgctgctattattaaagcgcgtggtgcatcatctgcc
gcttctgcagccaatgctgctatcgctcatatgcgtacttgggtacttggtactgatgag
aacgattgggtatcaatgggtgtatattcaaacggcgaatacggtattgccaaaggtttg
atctactcattcccatgcacttgtactaacggtgactggtctatcgttgatggcgttgat
gtgtcatcagcattctcaaaagagaaaatggcagccactgagcaagagcttagcgaagag
cgtgatgcagtagcgcacttactaccgtaa

DBGET integrated database retrieval system