KEGG   Psychrobacter arcticus: Psyc_1795Help
Entry
Psyc_1795         CDS       T00256                                 

Gene name
ahpF
Definition
(GenBank) probable alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
par  Psychrobacter arcticus
Brite
KEGG Orthology (KO) [BR:par00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Psyc_1795 (ahpF)
Enzymes [BR:par01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Psyc_1795 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA HI0933_like Thioredoxin_3 FAD_binding_2 Thi4 DAO NAD_binding_8 FAD_oxidored K_oxygenase FAD_binding_3 AlaDh_PNT_C NAD_binding_7 Lycopene_cycl 3HCDH_N Shikimate_DH NAD_binding_9 Thioredoxin_4 Glutaredoxin ThiF DSBA
Motif
Other DBs
NCBI-ProteinID: AAZ19643
UniProt: Q4FQR5
LinkDB All DBs
Position
complement(2205524..2207101)
Genome map
AA seq 525 aa AA seqDB search
MIDQSLLDAVKSYSANMTRPISFVLGSGEHSKRAELVDFLTKIAGTTDKINFDAQANDDT
LPSPISFKVINHIDGALMDTGIVFSGIPGGHEFTSLILAILQAGGHTLKLDEGIQKLIKR
FNKPLQFQTYVSLSCHSCPEVVQALNQFALLNDDISNEMIDGALFQEQVEANNIQGVPAV
FLNGKPFANGLIDTAKLIEKLQEQFPDLLAEADDDAEQLEQQDVTIIGAGPAGVAAAIYT
ARKGLKVTMVADRIGGQVKDTQDIENLISVPLTTGSELSANFEKHLREYNITLKEHVSVK
EISETADENYSIHLNTGETFETRSIILATGAQWRKLGVAGEEENIGKGVAFCAHCDGPFF
KGKDIAVVGGGNSGIEAALDLAGIVKHVTVLEFADDLKADQVLINKAKEKSNIDIITSAA
TQEIKATDGKVSSLVYQDRNSNDNKELDVAGVFVQIGLIPNTEFVKGFIDLNRFGEIEID
ERCRTDRKGIFACGDVTTVPFKQINIAMGEGSKAALSAFEYLVMQ
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgatagaccaaagcttattagatgcagtaaagagctatagcgcaaacatgacccgccca
atcagctttgtattgggtagcggcgagcatagcaagcgtgctgagctggttgactttttg
accaaaatcgctggtacgaccgataagattaattttgatgcacaagctaacgatgacact
ttaccaagcccaatcagctttaaagtaatcaatcatatcgatggcgctttgatggatacg
ggtattgtctttagtggtattccaggcggacatgaatttacttcattgatattggcaatt
ttgcaagccggtggtcatacgttaaagctggacgaaggcattcaaaagctcattaaacgc
tttaataagccgttacagtttcagacttatgtctcattatcttgccacagttgcccagaa
gttgtgcaagcgctgaaccaatttgcgctgctaaacgatgacatcagtaatgagatgatt
gacggtgcattgttccaagagcaagtagaagccaataatattcaaggtgtgccagcagta
tttttgaatggtaaaccttttgctaatggtctgattgacacggctaaattgattgagaag
ttgcaagagcaatttcctgacttgttagcagaagctgatgatgatgctgagcagttagag
cagcaagatgtgacgattatcggtgctggtcctgctggggttgctgcggcgatttatacc
gcgcgtaaaggtctaaaagtgacgatggttgctgaccgtatcggtgggcaggtgaaagat
acgcaagatattgagaatttaatctcggtgcctttaacgacgggtagtgagttatctgcc
aattttgaaaagcatttgcgcgaatacaacatcacgcttaaagagcatgtcagtgtcaaa
gagattagtgagactgctgatgaaaactacagcatccatctaaataccggtgagacgttt
gagacgcgcagtattatcttagcaactggtgctcagtggcgtaagctaggtgtcgctggc
gaagaagaaaacatcggtaaaggcgtggctttttgtgcgcactgtgacggtccattcttt
aaaggtaaagatattgccgtcgtcggtggcggtaactctggtatcgaagcggcattagat
cttgctggtatcgtgaagcatgtgaccgtgcttgagtttgctgatgatttgaaagcggat
caggtattgattaataaagccaaagaaaagtcaaatatcgatatcattaccagtgcagca
acccaagaaattaaagcgactgatggtaaagtatcgtctctcgtttatcaagatcgcaat
agcaacgacaataaagagcttgatgttgcaggggtgtttgtacagattggtttgataccc
aatactgagttcgtcaaaggcttcatcgatttaaaccgctttggtgagattgagattgat
gagcgctgccgcacagatcgcaaaggtatctttgcttgtggtgatgtaacgactgtaccc
tttaagcagattaatattgcgatgggtgaaggttcaaaagcggcattatcagcgtttgaa
tatttggtcatgcagtaa

DBGET integrated database retrieval system