KEGG   Paraburkholderia sp. SOS3: BTO02_01050Help
Entry
BTO02_01050       CDS       T04966                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
para  Paraburkholderia sp. SOS3
Pathway
para00010  Glycolysis / Gluconeogenesis
para00620  Pyruvate metabolism
para01100  Metabolic pathways
para01110  Biosynthesis of secondary metabolites
para01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:para00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTO02_01050
   00620 Pyruvate metabolism
    BTO02_01050
Enzymes [BR:para01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BTO02_01050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: APR34224
UniProt: A0A1L6HSQ6
LinkDB All DBs
Position
1:complement(238685..240205)
Genome map
AA seq 506 aa AA seqDB search
MNHAEMQFLSTDYPYKKQYANFIGGEWVKPAGGEYFDNISPITGEAFTSIPRSREADVEL
ALDAAHRAKASWGKTSAAGRANILSKIADRMEANLARLAVAETIDNGKPLRESTAADIPL
AIDHFRYFASCIRAQEGSISQIDEDTVAYHFHEPLGVVGQIIPWNFPILMAVWKLAPALA
AGNCVVLKPAEQTPASILVLMELIQDLLPPGVVNVVNGFGLEAGKPLASNKRIAKIAFTG
ETTTGRLIMQYASQNLIPVTLELGGKSPNIFFADVMDHDDSFFDKALEGFAMFALNQGEV
CTCPSRVLIEEKIYDRFIERAVKRVAAIAQGHPLDMQTMIGAQASQEQLEKILSYIDLGK
QEGAQCLIGGERNTLDGELGKGYYVKPTVFRGNNKMRIFQEEIFGPVVAVTTFRNEDEAL
DIANDTLYGLGAGVWTRDGTRAYRFGRQIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRET
HKMMLDHYQQTKNLLVSYSDKPLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacgcggagatgcagtttctaagcaccgattacccgtacaaaaagcagtacgcg
aattttatcggcggagaatgggtgaagccggccggcggcgagtatttcgacaatatctcg
ccgatcacgggcgaagcattcacgtcgattccgcgctcgcgggaagcggacgtcgaactc
gcgctcgacgccgcgcatcgcgcgaaagcgagctggggcaagacctcggccgccgggcgc
gcgaacatcctcagcaagatcgcggaccgtatggaagcgaatctcgcgcgtctcgcggtc
gcggagacgatcgacaacggcaagccgctgcgcgagtcgacggccgccgatatcccgctt
gcaatcgaccacttccgctattttgcaagctgcattcgcgcgcaggaaggctcgatctcg
cagatcgatgaagacaccgtcgcgtatcactttcatgagccgctgggcgtggtcggtcag
atcatcccgtggaatttcccgatcctgatggccgtgtggaagctcgcacccgcgctcgcc
gccggcaattgcgtcgtactgaagcccgcggagcaaacgcccgcttccatcctcgtgctg
atggaactgattcaggatctcctgccgcctggcgtggtgaacgtcgtgaacggcttcggc
ctcgaagcgggcaagccgctcgcttcgaataagcgcatcgcgaagatcgcgttcaccggc
gagacgaccacgggccgcctcatcatgcagtacgcgagccagaacctcattcccgtcacg
ctcgagctgggcggcaagagcccgaacatcttctttgccgacgtaatggaccatgacgac
agcttcttcgataaagcgctcgaggggtttgcgatgtttgcgctgaatcagggcgaggtg
tgcacgtgtccgtcgcgcgtgctgatcgaagagaagatctacgaccggttcatcgagcgc
gcggtcaagcgcgtcgcagccattgcgcaagggcacccgctcgatatgcagacgatgatc
ggtgcgcaggcctcgcaggaacagctcgaaaagatcctctcgtacatcgatctcggcaag
caggagggtgcgcaatgcctgatcggcggcgagcgcaatacgcttgacggcgaactcggc
aagggctactacgtgaaaccgaccgtgtttcgcggcaacaataaaatgcgcattttccag
gaagagatcttcgggccggtcgttgccgtgacgacgttcaggaacgaagacgaagcgctc
gatatcgcaaacgacacgctgtatggacttggcgccggcgtatggacgcgcgacggcacg
cgtgcatatcgcttcggccggcagattcaggccgggcgcgtctggacgaactgctatcac
gcgtatccggcgcatgccgcgttcggcggctacaagcaatcgggtatcggccgcgaaacg
cacaagatgatgctcgaccactatcagcagacgaagaacctgctcgtcagctatagcgac
aagccgctcggcttcttctaa

DBGET integrated database retrieval system