KEGG   Paraburkholderia sp. SOS3: BTO02_02275Help
Entry
BTO02_02275       CDS       T04966                                 

Definition
(GenBank) peptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
para  Paraburkholderia sp. SOS3
Pathway
para00550  Peptidoglycan biosynthesis
para01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:para00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BTO02_02275
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:para01002]
    BTO02_02275
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:para01011]
    BTO02_02275
Enzymes [BR:para01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BTO02_02275
Peptidases and inhibitors [BR:para01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   BTO02_02275
Peptidoglycan biosynthesis and degradation proteins [BR:para01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   BTO02_02275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: APR34432
UniProt: A0A1L6HSI2
LinkDB All DBs
Position
1:503918..505141
Genome map
AA seq 407 aa AA seqDB search
MRFSKPGFPSLASFVPQSISRAVMLGVVLPASLVVASSAFAQVPPPAVNARSWVLVDATS
NQVLASGNPDERVEPASLTKLMTAYLVFQALDAKKISMDQTVMPSVAVRRVGNDESRMFI
EANKPVTVHDLVYGMIVQSGNDAAIALAELVGGTETQFVAMMNAQAQKLGMKNTHFADVN
GMPDAQHYTTAGDLAVLSARLIRDYPDYYSIFSVKEFTYNKIKQPNRNRLLWLDPTVDGL
KTGHTEAAGYCLIATAKRPVAGVPDASRRLVTVMMGEPKEHDRVQDSLKMLNYGYSAYDL
VRLYKAGQVIETPRVYKGTQDTVKIGVNTDQYITVPKGLGDKLKPQVEHADPLIAPITAG
QQIGTAKLVSDGKTLAQFPVVALQPVPQAGIVGRVWDSLMLMFNKKK
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttttccaaacccggcttcccgtcactggcgtcattcgttccccaatccattagt
cgtgccgtgatgctcggcgtcgtgctgccggcatcgctcgtcgtcgcgagcagcgcgttc
gcgcaggtgccgccgccggccgtgaatgcgcgctcgtgggtgctcgtcgatgcgacgagc
aatcaggtgctcgcatccggcaatccggacgagcgcgtcgaacccgcgtcgctcacgaag
ctgatgaccgcctatctcgtgttccaggcgctcgacgcgaagaagatctcgatggatcag
accgtgatgccgagcgtcgcggtccgccgcgtgggcaacgacgaatcgcgcatgttcatc
gaggcgaacaagcctgtgaccgtgcacgacctcgtctacggcatgatcgtgcagtcgggc
aacgacgcggcgatcgcgctggccgagctggtcggcggcacggagacgcagttcgtcgcg
atgatgaacgcgcaagcgcaaaagctcggcatgaagaacacgcacttcgccgacgtgaac
ggcatgccggacgcgcagcactacacgaccgccggcgacctcgccgtgctgtcggcgcgc
ctgatccgcgactaccccgactactacagcatcttctcggtcaaggaattcacgtacaac
aagatcaagcagccgaaccgcaatcgcctgctgtggctcgacccgaccgtcgacggcctg
aagacgggccacacggaggccgccggctactgcctgatcgcgacggcgaagcgtccggtg
gcgggcgtacccgatgcgtcgcgccgcctcgtcaccgtcatgatgggcgagccgaaggaa
cacgaccgtgtgcaggacagcctcaagatgctgaactacggctatagcgcgtacgacctc
gtgcgtctgtacaaggcggggcaggtgatcgaaacgccgcgcgtctacaaaggcactcag
gatacggtcaagatcggcgtgaacaccgaccagtacatcacggtgccgaagggtctcggc
gacaagctcaagccgcaggtcgagcatgccgatcccttgattgcgccgatcacggcgggc
cagcagatcggcaccgcgaagctcgtgtcggatggcaagacgctggcgcagttcccggtc
gtcgcgctgcagccggtgccgcaggcgggtatcgtcggccgcgtatgggattcgctgatg
ctgatgttcaacaagaagaagtaa

DBGET integrated database retrieval system