KEGG   Paraburkholderia sp. SOS3: BTO02_05825Help
Entry
BTO02_05825       CDS       T04966                                 

Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
para  Paraburkholderia sp. SOS3
Pathway
para00040  Pentose and glucuronate interconversions
para00051  Fructose and mannose metabolism
para01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:para00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BTO02_05825
   00051 Fructose and mannose metabolism
    BTO02_05825
Enzymes [BR:para01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     BTO02_05825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Methyltransf_25 Methyltransf_11 TrkA_N AlaDh_PNT_C ADH_N_assoc ThiF
Motif
Other DBs
NCBI-ProteinID: APR37454
UniProt: A0A1L6I1U8
LinkDB All DBs
Position
1:1273928..1274944
Genome map
AA seq 338 aa AA seqDB search
MRAAVMHRPGDIRVEEVEKPSVRPGHALVRVAACGVCGSDIPRMLSKGAHVMPLICGHEF
AGFVEALGSGVEGFSVGELVTVPPLIPCLKCDQCMRGHPSRCLDYDYFGSRRDGAYAEFV
GVPATNLVKVPQTMDPTAASLVDPAAIAIHAIWQGELKAGQNAAVVGCGPIGLFAIQWMK
LMGARNIVAIDIAEDKLEMARTAGATHTLLSGQPDADLPRCHLIVEAAGHPSAINQAVQL
AGPGGHVVFIGIPTADVALTSKSFSHFLRQEVSLHGAWNSFSGPFPGDEWTAAIDKLATG
ALRWDFMITHDLPLEALPDMFQHFAEKKGAAKVVFRPS
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
gtgcgagcagctgtcatgcatcggccgggcgacatccgtgtcgaagaagtcgaaaaaccg
tctgtgaggccgggccacgcactcgtgcgcgtggccgcgtgcggcgtgtgcgggtccgat
atcccgcgcatgctgagcaagggcgcgcatgtgatgccgctgatttgcggtcacgaattc
gcgggcttcgtcgaagcgctcggcagcggcgtggaaggcttttcggtcggcgaactggtg
accgtgccgccgctgattccgtgtctgaaatgcgatcaatgcatgcgcgggcatccgtcg
cgttgtctcgactacgactacttcggcagccgccgcgacggcgcctatgccgagtttgtc
ggcgtaccggcaaccaatctcgtgaaagtgccgcagacgatggacccgaccgcggcctcg
ctcgtcgatcccgctgcgatcgcgattcacgcgatctggcagggcgaactgaaggccggc
cagaacgccgccgtggtcggctgcggaccgatcggcctgttcgcgattcaatggatgaag
ctgatgggcgcgcgcaacatcgtcgcgatcgacatcgcggaagacaagctcgagatggcg
cgcaccgcgggcgccacgcacacgctgctaagcggccagcccgatgcggatctgccgcgt
tgccatctgatcgtcgaagcggcgggccacccgagcgcgatcaatcaggccgtgcagctc
gcgggcccgggcggccacgtggtgttcatcggcattccgaccgccgacgtcgcgctgacg
agcaagagcttttcgcactttctgcgtcaggaagtctcgttgcacggcgcatggaattcg
ttctcgggcccgttccccggcgacgagtggaccgctgcgatcgacaagctcgcgaccggc
gcgctgcgctgggacttcatgatcacgcacgatcttccgctcgaggcgctgcccgacatg
ttccagcatttcgcggaaaagaagggggcggccaaagtcgtgttccgtccgtcgtag

DBGET integrated database retrieval system