KEGG   Paraburkholderia sp. SOS3: BTO02_06610Help
Entry
BTO02_06610       CDS       T04966                                 

Definition
(GenBank) NAD(P)-dependent alcohol dehydrogenase
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
para  Paraburkholderia sp. SOS3
Pathway
para00040  Pentose and glucuronate interconversions
para01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:para00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BTO02_06610
Enzymes [BR:para01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     BTO02_06610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 RcsD_ABL
Motif
Other DBs
NCBI-ProteinID: APR35154
UniProt: A0A1L6HVC5
LinkDB All DBs
Position
1:1437230..1438264
Genome map
AA seq 344 aa AA seqDB search
MEALVLESAQRISLRPFSLPQTVGPRDVRIRINTVGICGSDIHYYQHGRIGPFVVTEPMV
LGHEAAGTVVQVGDEVTNLKPGDRVCMEPGVPDMESRASREGMYNLDPKVRFWATPPVHG
CLAPFVVHPAAFTYKLPDNVSFAEGAIVEPLSIGLQAAKKAAIKPGDVAVVLGAGTIGMM
CALGALAGGCSRAIVCDLVPEKLELIGNTPGVTTVDIRNTSVKDVVNKLTDGWGANVVLE
ASGSAKAFEGIVDLLCPGGCLVLVGMPQNPVPLDVVALQIKEARVESVFRYANIFPRAIQ
LIASGRIDVKPFISRTFPFAEGIKAFEEAASGKPTDVKVQIVME
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggaagctctggttctcgaaagcgcacagcgcatcagcttgcggccgttcagcctgccg
cagacggtcgggccgcgcgatgtgcgcatccgcatcaacacggtcggtatttgcggcagc
gacattcactactatcagcacggccgcatcgggccgtttgtcgtgacggagccgatggtg
ctcgggcatgaggcggccggcacggtcgtgcaggtgggcgacgaagtgacgaatctgaaa
cccggcgatcgggtttgcatggagcccggcgtgcccgatatggaatcgcgtgcatcgcgc
gagggcatgtacaacctcgatccgaaagtgcgcttctgggcgacgccgcccgtgcacgga
tgtcttgcgccgtttgtcgtacatccagccgcgttcacgtacaagctgccggataacgtg
agttttgcggagggcgcgattgtcgagcccttgtcgatcggcttgcaggcagcgaagaaa
gccgcgatcaaaccaggcgacgtggcggttgtgcttggtgcaggcacgatcggtatgatg
tgtgcgcttggcgcactcgcggggggatgcagtcgcgcgatcgtttgcgatctcgtgccg
gagaagctcgagttgattggaaatacgccgggcgtaacgacggtggatattcgtaatacg
tcggtcaaggatgtggtgaacaaactgaccgacggctggggggcgaacgttgtgctagaa
gcgagcggcagcgccaaggcgttcgaggggattgtcgatctgctgtgccctggcggatgt
ctggtgctggtcggcatgccgcagaatccggtgccgctcgatgtggtcgcattgcagatc
aaggaggcacgggtcgaatcggtgttccgctatgccaatattttcccgcgtgcgattcag
ctgatcgcgtcgggacgtatcgatgtgaagccgtttatttcgcgaacgtttccgttcgcg
gaaggtatcaaggcattcgaggaagcggcgagcgggaagccgaccgatgtgaaggtgcag
atcgtgatggagtga

DBGET integrated database retrieval system