KEGG   Paraburkholderia sp. SOS3: BTO02_07850Help
Entry
BTO02_07850       CDS       T04966                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
para  Paraburkholderia sp. SOS3
Pathway
para00620  Pyruvate metabolism
para00680  Methane metabolism
para01100  Metabolic pathways
para01120  Microbial metabolism in diverse environments
para01200  Carbon metabolism
Module
para_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:para00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BTO02_07850
  09102 Energy metabolism
   00680 Methane metabolism
    BTO02_07850
Enzymes [BR:para01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BTO02_07850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 K1377
Motif
Other DBs
NCBI-ProteinID: APR35349
UniProt: A0A1L6HV63
LinkDB All DBs
Position
1:complement(1704824..1708147)
Genome map
AA seq 1107 aa AA seqDB search
MTSSGSARRARRNTASLESGLEPSARAFAQSTMAAEAAGNGNGDGNADGVSASRTQRIAQ
AARIEKADKAVKPVKPPKAAKAAEAPKAPKAPKAAQTAKVAKVVKAARSAPVQKNLAVKA
RKGKHAKPAANGAAGPAAMPVDKSAAKPRQTARANASASGIAALAAAAPKDGRTREDKDQ
PLFEDIRYLGRLLGDVVREQEGDAVFDVVETIRQTAVRFRREDDSVAAQTLDKKLRALNP
AQTVSVVRAFSFFSHLANIAEDRHHNRRRRIHELAGSSAQPGTVAHALERLEKAGAAPTP
VVQQFFDDALIVPVLTAHPTEVQRKSILDAQHDIARLLAERDQPLTAREHAQNDALLRAR
VTSLWQTRMLRDSRLTVADEIENALSYYRATFLAEIPALYADIEAALAEHGLASRLPPFF
QMGSWIGGDRDGNPNVTAETLALAMSRQATVIFEHYLEQIHQLGAELAVSYLLAGSSDAL
KALADASPDRSPHRVDEPYRRALIGVYARMAATARERLGEGVVAMRQASRDAKPYADADE
FVRDLDVLIESLAQHHGESLATPRLSPLVRAAEVFGFHLASIDLRQSSDVHEAVIAELLQ
RAGVVEDYAALSEAEKLEVLLAELAQPRLLRSPYIKYSDLVASELGVLEEARVTREKFGI
RAVRNYIISHTETVSDLVEVMLLQKETGLLQGLLGAAHAPARAGLMVVPLFETIPDLRNA
PHIMRDLMALPGIEAIIEHQGNEQEVMLGYSDSNKDGGFLTSNWELYRAELALVSLFNER
GITLRLFHGRGGTVGRGGGPTYQAILSQPPGTVDGQIRLTEQGEVIASKFGNPEIGRRNL
ETVIAATLEASLAPHGHAPAQLPAQLSVFEDTMQSFSDAAMQAYRALVYETPGFVDYFFA
STPITEIAELNIGSRPASRKLQDPKNRKIEDLRAIPWGFSWGQCRLLLTGWYGFGSAIAG
WLDASANDSERTRRVQLLRQMHKTWPFFSNLLSNMDMVLAKTDLAVASRYAQLVEDKKLR
KLVFERIVAEWERTSNVLSEITGRKERLADNPLLARSIKNRFPYLDPLNHLQVELLKRHR
AGDDNTRLRRGIHLTINGIAAGLRNTG
NT seq 3324 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtcttccggatcggcgcgccgcgcgcgccgcaatactgcatcgctcgaaagcggc
ctcgaaccgtccgctcgcgccttcgcgcaatcgaccatggccgcagaagccgccggcaac
ggcaacggcgatggcaacgccgacggcgtaagcgccagccgcacccaacgcatcgctcag
gcagcgcgcatcgagaaggcggacaaagccgtcaagccggtcaagccgccgaaggccgct
aaggccgctgaggcccctaaagcccctaaagcccctaaggccgctcaaaccgccaaggtc
gccaaggtcgtgaaagccgcccgctccgcgcccgtacagaaaaacctcgccgtcaaagcg
cgcaaaggcaagcacgccaaaccggccgccaacggcgcggccggcccggcggccatgcct
gtcgataaaagcgcggcgaagccgcggcaaacagcgcgcgccaacgcgtcggccagcggc
atcgccgcgctcgccgcagccgcgccaaaagacggccgtacgcgcgaagacaaagaccag
ccgcttttcgaagacatccgctatctgggccgcctgctcggcgacgtcgtgcgcgagcag
gaaggcgatgcggtattcgacgtcgtcgaaacgatccgccagacggccgtgcgctttcgc
cgcgaggacgacagcgtcgcggcgcagacgctcgacaagaagctgcgcgcgctgaatccg
gcgcagaccgtcagcgtcgtgcgcgccttcagctttttctcgcacctcgcgaatatcgcg
gaagaccgccatcacaaccggcggcgccggattcacgagctggcgggttcgtcggcgcag
ccgggcacggtcgcgcacgcgctcgagcggctcgagaaggccggcgccgcgccgacgccg
gtcgtgcagcagttcttcgacgacgcgctgatcgtgccggtgctgaccgcgcacccgacc
gaagtgcagcgcaagagcattctcgacgcgcagcacgacatcgcacgcctgcttgccgag
cgcgatcagccgctgaccgcgcgcgagcacgcgcaaaacgacgccctgctgcgcgcgcgc
gtcacctcgctgtggcaaacgcggatgctgcgcgactcgcgcctcaccgtcgccgacgaa
atcgagaacgcgctgtcgtattaccgcgcgacgttccttgccgagattcccgcgctctat
gcggacatcgaggcggcgctcgccgagcacgggctcgcgtcgcgtctgccgccgttcttc
cagatgggcagctggatcggcggcgaccgcgacggcaatccgaatgtgacggccgaaacg
ctcgcgctcgcgatgtcgcgccaggcaaccgtgatcttcgagcattacctcgagcagatt
caccagctcggcgccgaactcgcggtgtcgtatctgctcgccggcagcagcgacgcgttg
aaggccctggccgacgcgtcgccggaccgctcgccgcaccgcgtcgacgagccgtaccgc
cgcgcgctgatcggcgtctacgcgcggatggcggccaccgcgcgcgaacgtctcggcgaa
ggcgtcgtcgcgatgcgccaggccagccgcgacgcaaaaccgtacgcggatgccgacgaa
ttcgtgcgcgacctcgacgtgctgatcgaatcgctcgcgcagcatcacggcgaatcgctc
gcgacgccgcggctgtcgccgctcgtgcgggcggccgaagtgttcggcttccatctcgcg
tcgatcgacctgcgccagagttccgacgtgcacgaggcggtgatcgccgaactgctgcag
cgcgcaggcgtggtcgaagactatgcggcgctgtccgaagcggaaaagctcgaggtgctg
ctcgccgaactggcgcagccgcgcctgctgcgctcgccctatatcaagtattcggacctc
gtcgcaagcgaactcggcgtgctcgaggaagcgcgcgtgacgcgcgaaaaattcggcatc
cgcgcggtgcgcaactacatcatctcgcacaccgagacggtcagcgacctcgtcgaagtg
atgctgctgcagaaagaaaccggcctgctgcaaggcctgttgggcgccgcgcatgcgccg
gcgcgcgcagggctgatggtggttccgctcttcgaaacgattcccgacctgcgcaacgcg
ccgcacatcatgcgcgacctgatggcgctgcccggcatcgaggcgatcatcgagcatcag
ggcaacgagcaggaagtgatgctcggctactcggacagcaacaaggacggcggctttctc
acgtcgaactgggagctgtaccgtgcggaactcgcgctcgtgtcgctcttcaacgaacgc
ggcatcacgctgcggctgttccacggccgcggcggcacggtcggccgcggcggcggcccg
acctatcaggcaattctctcgcagccgcccggcaccgtcgacggccagatccgcctgacc
gagcagggcgaagtgatcgccagcaagttcggcaatccggaaatcggccggcgcaatctc
gaaaccgtgatcgcggccacgctcgaagcatcgctcgcaccgcatggccatgcgccggcc
cagttgcccgcgcaactgtccgtcttcgaggacacgatgcaaagcttctccgatgcggcg
atgcaggcgtaccgcgcgctcgtctacgaaacgccgggctttgtcgactacttcttcgcc
tcgacgccgatcaccgaaatcgccgagctcaatatcggcagccgtcccgcgtcgcgcaag
ctgcaggatccgaagaaccgcaagatcgaagacctgcgcgcgattccgtggggcttttcg
tggggccaatgccgcctgctgctgacgggctggtacggcttcggcagcgcgatcgcgggc
tggctcgacgcatcggccaacgacagcgaacgcacgcgccgcgtgcagctgctgcgccag
atgcacaagacctggccgttcttttcgaacctgctgtcgaacatggacatggtgctggcg
aaaaccgacctcgcggtcgcgtcgcgctatgcgcagctcgtcgaagacaagaagctgcgc
aagctcgtgttcgaacgcatcgtcgcggaatgggagcgcacgtcgaacgtactgtcggaa
atcacgggcagaaaggagcgccttgccgacaacccgctgctcgcgcgttcgatcaagaac
cgctttccgtatctcgatccgctgaaccatctgcaggtcgagttgctgaagcgccatcgc
gccggcgacgataacacgcgcttgcggcgcgggattcatttgacgatcaacggtatcgcg
gccggtttgcgcaataccggttaa

DBGET integrated database retrieval system