KEGG   Paraburkholderia sp. SOS3: BTO02_09455Help
Entry
BTO02_09455       CDS       T04966                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
para  Paraburkholderia sp. SOS3
Pathway
para00061  Fatty acid biosynthesis
para00780  Biotin metabolism
para01100  Metabolic pathways
para01130  Biosynthesis of antibiotics
para01212  Fatty acid metabolism
Module
para_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:para00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BTO02_09455
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BTO02_09455
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    BTO02_09455
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:para01004]
    BTO02_09455
Enzymes [BR:para01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BTO02_09455
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BTO02_09455
Lipid biosynthesis proteins [BR:para01004]
 Fatty acid synthase
  Component type
   BTO02_09455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase KR
Motif
Other DBs
NCBI-ProteinID: APR35612
UniProt: A0A1L6HVY4
LinkDB All DBs
Position
1:complement(2073554..2074348)
Genome map
AA seq 264 aa AA seqDB search
MGFLAGKRILLTGLLSNRSIAYGIAQACKREGAELAFTYVGDRFKDRITEFATEFGSNLV
FPCDVGDDAQIDALFASLGQHWNSLDGLVHSIGFAPREAIAGDFLDGMTRENFRIAHDIS
AYSFAALAKAAQPMLSNDAALLTLTYLGSERAIPNYNTMGLAKASLEASVRYLAVSLGNK
GVRVNGISAGPIKTLAASGIKGFGKILDFVEDNAPLKRNVTIEQVGNTAAFLLSDLAAGV
TAEIVHVDSGFNAVVGGMAAAAAE
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgggcttcctcgctggtaaacgtatcctgctgaccggcttgctgtcgaatcgttccatc
gcttacggcatcgcgcaggcttgcaagcgcgaaggcgccgaactcgcattcacgtatgtc
ggcgatcgcttcaaggatcgcattaccgagttcgccaccgagttcggcagcaacctcgtc
ttcccgtgcgacgtcggcgacgatgcgcagatcgatgcactctttgcctcgctcgggcaa
cactggaatagcctcgacggcctcgtgcactcgatcggctttgcgccgcgcgaagcgatc
gcgggcgacttcctcgacggcatgacgcgcgaaaacttccgcatcgcgcacgacatttcc
gcctatagcttcgcggcactcgcgaaagccgctcagccgatgctgtcgaacgatgcggcg
ctgctcacgctgacctacctcggctccgagcgcgcgattccgaactacaacacgatgggc
ctcgcaaaggcatcgctcgaagcgagcgtccgatatctcgccgtgtcgctcggcaacaag
ggcgtgcgcgtcaacggtatttcagcgggtccgatcaagacgctcgcggcaagcggcatc
aagggcttcggcaagattctcgatttcgtcgaagacaatgcgccgctcaagcgcaacgta
acgatcgaacaggtcggcaatacggcggcattcctgctgtccgatctcgcagctggcgtg
acggcggagatcgtgcatgtcgacagcggcttcaatgcggtggtcggcgggatggcggca
gccgcggctgagtaa

DBGET integrated database retrieval system