KEGG   Paraburkholderia sp. SOS3: BTO02_09680Help
Entry
BTO02_09680       CDS       T04966                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
para  Paraburkholderia sp. SOS3
Pathway
para00473  D-Alanine metabolism
para01100  Metabolic pathways
para01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:para00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BTO02_09680
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BTO02_09680
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:para01011]
    BTO02_09680
Enzymes [BR:para01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BTO02_09680
Peptidoglycan biosynthesis and degradation proteins [BR:para01011]
 Precursor biosynthesis
  Racemase
   BTO02_09680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: APR35643
UniProt: A0A1L6HVW6
LinkDB All DBs
Position
1:2121074..2122144
Genome map
AA seq 356 aa AA seqDB search
MPRPLLATIHTAALANNLAVVRRYAPKSKIWAIVKANAYGHGLARAFPGLRATDGFGLLD
LEEAVKLRELGWAGPILLLEGFFRPTDIDLIDRYSLTTALHSDEQLRMLEMARLSKPVNI
QLKMNSGMNRLGYTPDRFRAAWERARACPGVGQITLMTHFSDADSERGIEHQMEAFERGA
KGIAGARSLANSAATLWHPKSHFDWVRPGVMLYGASPSGVHSDVRSTGLQPAMTLASELI
AVQTLPEGETIGYGSTFKTRAGMRIGVVACGYADGYPRVAPEGTPIVVDGIRTRIVGRVS
MDMITVDLTPCPQAGVGSRVELWGNALPIDDVAQACGTIGYELMCAVAMRVPVRAE
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcccgctccttgccacgatccataccgccgctctcgccaacaatctcgccgtg
gttcgacgctacgcgccgaagtccaaaatctgggcaatcgtcaaggcgaatgcgtatggc
cacgggcttgcgcgtgcgttcccggggttgcgcgccacggacggctttgggttgctggac
ctcgaagaagcggtgaagttgcgcgaattgggctgggcgggcccgattttgttgctcgaa
ggattctttcgtccgaccgatatcgatctgatcgaccgctacagcctcaccacggcgctg
cactcggacgagcagctgcgcatgctcgaaatggcgcggctgtccaagccggtcaatatt
cagctcaagatgaacagcggcatgaaccgcctcggctatacgcctgacaggttccgcgcc
gcctgggagcgcgcgcgcgcgtgccccggtgtcggtcagatcacgctgatgacccacttt
tccgatgccgacagcgagcgcggcatcgagcatcagatggaagcgttcgagcgcggcgcg
aagggcatcgcgggtgcgcgcagcctcgcgaattcggcggcgacactgtggcatccgaag
tcgcatttcgactgggtgcgtcccggcgtcatgctgtacggggcgtcgccgtcgggcgtg
cattccgatgttcgcagcacggggctgcagccggccatgacgctcgcgtcggaactgatc
gccgtgcagacgctgcccgagggcgagacgatcggctacggttcgaccttcaagacgcgt
gcgggcatgcgcatcggcgtcgtcgcctgtggttacgcagacggttacccgcgcgtcgcg
cccgaaggcaccccgatcgtcgtcgacggcattcgcacgcgcatcgtcgggcgcgtgtcg
atggacatgatcaccgtcgatctgacgccgtgtccgcaggccggtgtcggctcgcgtgtc
gaactctggggcaacgcattgccgatcgacgacgtcgcgcaggcgtgcggcacgatcggc
tacgaactcatgtgcgcggtcgcgatgcgcgtgccggtccgcgcggaataa

DBGET integrated database retrieval system