KEGG   Paraburkholderia sp. SOS3: BTO02_10455Help
Entry
BTO02_10455       CDS       T04966                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
Organism
para  Paraburkholderia sp. SOS3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: APR35772
UniProt: A0A1L6HWE0
LinkDB All DBs
Position
1:2299575..2301011
Genome map
AA seq 478 aa AA seqDB search
MKTYDQFYIDGKWLSPCGTGTIDVIDSGTEAVMGRIPEGIEADAEAAIAAARAAFDAWAA
TLPQQRGAYLQKIADNLKARTDELAQLICGEVGMPIKLSRAIQVGGAVQNWYAYAKLAGE
FAFEEKVGHSLVVREPVGVVAAITPWNYPLNQITLKVAAALAAGCTVVLKPSEIAPLNAF
VLAEAIHEAGLPAGVFNLVCGYGPVVGEVLASHPSVDMVSFTGSTRAGKRVSELAAATVK
RVALELGGKSASVILDDADLPAAVKATVGACFLNSGQTCSAHTRMLVPESRYDEVRALAK
SAAESYVPGDPRHDRTRLGPLASAAQQQRVQQYIARGIEEGADLVTGGPGMPDGIQQGFF
AKPTVFGRVHPKATIAQEEIFGPVLTILTFKDEDEAVRIANDSVYGLAGAVWAGSDERAL
GIARRMRTGQVNINGGAWNAAAPFGGYKQSGYGRENGTYGLDEYLEYKAMQFAVNKTT
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaagacctacgatcagttctacatcgacggcaaatggctgagcccgtgcggcaccggc
acgatcgacgtgatcgactccggcactgaagcggtgatgggccgcattcccgaaggcatc
gaagcggacgcggaagccgcgattgccgcggcgcgcgccgccttcgacgcctgggccgcg
acgttgccgcaacagcgcggcgcgtacctgcaaaaaatcgccgacaacctcaaggcccgc
accgacgaactcgcgcaattgatctgcggcgaagtcggcatgccgatcaagctgtcgcgc
gcgattcaggtcggcggcgccgtacagaactggtacgcgtacgccaagctcgcgggcgaa
ttcgcgtttgaagagaaggtcggccattcgctcgtcgtgcgcgaaccggtcggcgtcgtc
gcggcgatcacgccgtggaactatccgctgaaccagatcacgctgaaggttgcggcggcg
ctcgcggccggctgcacggtcgtgctgaagccgtcggagatcgcgccgctcaatgcgttc
gtgctcgccgaggcgattcatgaagcgggcttgccggccggcgttttcaaccttgtctgc
ggctatgggccggtggtcggcgaagtgctcgcgtcgcatccgtcggtcgatatggtgtcg
ttcacgggctcgacgcgcgcgggcaagcgcgtgtccgagcttgccgcggcgaccgtcaag
cgcgtcgcgctcgaactgggcggcaaatccgcctcggtgattctcgacgacgcggacctg
ccggccgccgtgaaggcgaccgtcggcgcatgctttctgaactcggggcagacctgctcc
gcgcatacgcgcatgctcgtgcccgaaagccgctacgacgaagtgcgcgcgctcgcgaaa
agcgcggccgaaagctacgtacccggcgacccgcgccacgacagaacgcgcctcggtccg
ctcgcatcggccgcgcagcaacaacgcgtgcagcagtacatcgcgcgcggcatcgaagag
ggcgcggacctcgtgaccggcggtcccggcatgccggacggcatacagcaaggcttcttc
gcgaaaccgaccgtgttcggccgcgtgcatccgaaggcgacgatcgcgcaggaggaaatc
ttcggccccgtgctgacgattctcacattcaaggacgaagacgaagccgtccgcatcgcg
aacgattcggtctatggtctcgccggcgccgtatgggcgggcagcgacgaacgcgcgctc
ggcatcgcgcgccggatgcgcacggggcaggtcaatatcaacggcggcgcgtggaatgcg
gccgcgccgttcggcggctacaagcagtcgggctatggccgtgagaacggcacgtatggc
ctcgacgaatatctcgagtacaaggcgatgcaattcgccgtcaacaagacgacgtaa

DBGET integrated database retrieval system