KEGG   Paraburkholderia sp. SOS3: BTO02_16495Help
Entry
BTO02_16495       CDS       T04966                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
para  Paraburkholderia sp. SOS3
Pathway
para00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:para00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BTO02_16495
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:para02000]
    BTO02_16495
Enzymes [BR:para01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BTO02_16495
Transporters [BR:para02000]
 Other Transporters
  Pores ion channels [TC:1]
   BTO02_16495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_2 GST_C_3 Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: APR36737
UniProt: A0A1L6HZ43
LinkDB All DBs
Position
1:complement(3690618..3691277)
Genome map
AA seq 219 aa AA seqDB search
MTLKLYAHPFSSYCQKVLVALYENGTPFEWRELSPDNRQLTEEFAALWPIRRFPLLVDEG
RTVIESTVIIEYLGLHYPGPVQLVPDDRDAAIEVRSMDRFFDNYVSTPQQKIVFDALRPE
AERDMRGVADARAMLDTAYGWLDRTMANRTWAAGEHFSLADCAAAPSLFYADWTHRIGAA
FPNVIAYRQRLLARPSFARAVDEARPYRPLFPLGAPERD
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgacgctcaagctctacgcccaccctttctcttcgtactgccagaaggttctggtcgcg
ctctatgagaacggcacgccgttcgaatggcgcgagctttctcccgacaatcggcagctg
accgaggaattcgcggcgctatggccgatcaggcgctttccgctgctcgtcgacgagggc
cgcacggtcatcgaatcgaccgtcatcatcgaatatctgggcttgcactatccgggcccg
gtacagctcgtgcccgatgatcgcgatgccgcgatcgaagtgcggagcatggaccgcttt
ttcgacaattacgtctcgacgccgcagcagaagatcgttttcgatgcgttgcggcccgaa
gccgagcgcgatatgcgcggcgtcgccgatgcgcgcgcgatgctcgacacggcctacgga
tggctcgaccgcacgatggcgaatcgcacgtgggccgcgggcgagcacttcagccttgcc
gactgcgcggccgcgccttccctgttttatgcggattggacgcatcggatcggcgccgca
tttccaaatgtgatcgcataccggcagcggctgctcgcgcggccttcattcgcccgcgcg
gtcgacgaagcgcggccataccggccgctttttccgctgggcgcgccagagcgcgattga

DBGET integrated database retrieval system