KEGG   Paraburkholderia sp. SOS3: BTO02_18315Help
Entry
BTO02_18315       CDS       T04966                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
para  Paraburkholderia sp. SOS3
Pathway
para00473  D-Alanine metabolism
para00550  Peptidoglycan biosynthesis
para01100  Metabolic pathways
para01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:para00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BTO02_18315
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BTO02_18315
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BTO02_18315
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:para01011]
    BTO02_18315
Enzymes [BR:para01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BTO02_18315
Peptidoglycan biosynthesis and degradation proteins [BR:para01011]
 Precursor biosynthesis
  Amino acid ligase
   BTO02_18315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATPgrasp_ST TTL ATP-grasp ATP-grasp_3 ATPgrasp_YheCD PPR ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: APR37034
UniProt: A0A1L6I0L1
LinkDB All DBs
Position
1:complement(4118171..4119115)
Genome map
AA seq 314 aa AA seqDB search
MSSSFDPKDFGKVAVLLGGESAEREVSLNSGRLVLQGLREAGIDAHPFDPSERPLAALKE
EGFVRAFNALHGGYGENGQIQGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQLGVPTP
PFEAVLRGDDYAARAQDIIAKLGLPLFVKPASEGSSVAVIKVKAADALVAALEEAAKYDT
IIVVEKSIEGGGEYTACVCGDLDLPIIRIVPAGEFYDYHAKYIADTTQYLIPCGLDAAEE
KRLKALSRRAFDVLGCTDWGRADFMMDAEGNPYFLEVNTAPGMTDHSLPPKAARAVGISY
SELVVKILSLTLKD
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcagtttcgatccgaaagacttcggaaaagtggccgtgctgctcggcggcgag
tccgccgagcgcgaagtgtcgctgaactccggccgtctcgtgttgcagggcctgcgcgaa
gcgggcatcgacgcgcatccgttcgacccgtccgaacggccgctcgcggcgctgaaagaa
gaaggcttcgtgcgcgcattcaatgcgctgcatggcggctatggcgagaacggccagatc
cagggcgcgctcgatttctacggcatccgttacacgggcagcggcgtgctcggctcggcg
ctcgggctcgacaagttccgcacgaagctcgtctggcagcagctcggcgtgccgacgccg
ccgttcgaagcggtgctgcgcggcgatgactatgccgcgcgcgcgcaagacatcatcgcg
aagctcggcttgccgctcttcgtgaagccggcaagcgaaggctcgagcgtggccgtgatc
aaggtgaaggcggccgatgcgctcgtcgccgcgctcgaggaagcggcgaagtacgacacg
atcatcgtcgtggaaaaaagcatcgaaggcggcggcgaatacacggcgtgcgtgtgcggc
gatctcgatctgccgatcatccgcatcgtgccggccggcgaattctacgactaccacgcg
aagtacatcgccgacaccacgcagtacctgattccgtgcggtctcgacgcggccgaagag
aagcggctcaaggcgctgtcgcgccgcgcgttcgacgtgctcggctgcaccgattggggc
cgcgccgatttcatgatggacgccgaaggcaacccgtatttcctggaagtgaacacggcg
ccgggcatgaccgatcattcgctgccgccgaaggcggcgcgcgcggtcggcatcagctat
tcggagctggtcgtgaagatcctgtcgctgacgctgaaagactga

DBGET integrated database retrieval system