KEGG   Paraburkholderia sp. SOS3: BTO02_20390Help
Entry
BTO02_20390       CDS       T04966                                 

Definition
(GenBank) maltose alpha-D-glucosyltransferase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
para  Paraburkholderia sp. SOS3
Pathway
para00500  Starch and sucrose metabolism
para01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:para00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BTO02_20390
Enzymes [BR:para01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BTO02_20390
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     BTO02_20390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap APH hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: APR37921
UniProt: A0A1L6I2G4
LinkDB All DBs
Position
2:67408..70881
Genome map
AA seq 1157 aa AA seqDB search
MKRDDPSENALQATIADPTVEEPVTEHRPARRRKASTLSDDPLWYKDAIIYQVHIKSFFD
ANNDGIGDFPGLLAKLDYIAELGVDAIWLLPFYPSPRRDDGYDIADYRNVHPDYGTLGDV
KRFIQEAHARGIRVITELVINHTSDQHPWFQRARRAKPGSNHRNYYVWSDTDQKYTGTRI
IFIDTEPSNWTHDPVAGAYYWHRFYSHQPDLNFDNPAVLREVLQVMRFWLDMGIDGLRLD
AVPYLVEREGTNNENLPETHAILKKIRATIDAEYPNRMLLAEANQWPEDVQEYFGNEDEC
HMAFHFPLMPRIYMAIASEDRFPITDIMKQTPDLADSCQWAIFLRNHDELTLEMVTDSER
DYLWNTYATDRRARLNLGIRRRLAPLMERDRRRIELINSLLLSMPGTPVIYYGDELGMGD
NIHLGDRDGVRTPMQWSSDRNGGFSRADPEQLVLPPVMGSLYGFDAVNVEAQSRDPHSLL
NWTRRMLATRRSKHAFGRGTIRFLKPSNRKILAYLREMPGEPAILCVANLSRAPQAVELD
LSEFAGTVPVEMTSDSVFPAIGQLSYLLTFPPYGFLWFLLCSSNQRPTWSQAPSEALPDF
VTIVIREGQAGPTPENVRLLESEVLPSWLVRRRWFASKDQKLNAVRLAALTTIPEAGFAF
TEIEADVGTSGNEHTERYVLPLAITWGADTTTPLFMQLALARVRRARNIGHLTDAFALPQ
FAYGTLKKLRERAAVPTVQKSEIRFIPTDRFDELELGDAPEIRWLAAEQSNSSLVIADAI
VLKLVRRLMNGVHPEAEMTRYLTLRGYANTAPLYGEVVRVDPQGVPHTLSILQGFVDNQG
DAWNWALDYLRRTIDELALAIDGEPTQDRINEEEAFDGYSMFIGMIGKRLGELHVVLAAP
SDDPAFSPEPATGEQVRAWIDGTQSMLAAALDVLERSTEHLSEDSLLLARSVLDRRELLV
EAVENLVNADANALCTRIHGDFHLGQVLVAQGDAFLIDFEGEPARSLEERRAKSSPLRDV
AGLLRSLSYASAAAQSTTEAAPQPTADRKRALFDRFRTHAAEAFLAEYRKALEASPQRIV
APADEQALLDLFLIEKAAYEIRYEAANRPSWLGLPVRGLAALTSRLLGDTGTPAGSPIQH
SPGGSAPPNDAAEGDYE
NT seq 3474 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtgacgatccttctgaaaacgcattacaggcaaccatcgccgatccaaccgtc
gaagaaccggtcacggagcatcggcccgcgcggcgccgcaaagcgtcgacgctgtccgac
gatccgctctggtacaaggacgcgatcatctatcaggttcacatcaagtcgttcttcgat
gcgaacaacgacggcatcggcgattttcccggcctgctcgcgaagctcgactacatcgcg
gaactcggcgtcgatgcgatctggctgctgcctttctatccgtcgccgcgccgcgacgac
ggatacgacatcgccgactatcgcaacgtgcatcccgactacggcacgctcggcgacgtc
aaacgcttcatccaggaagcacacgcgcgcggcattcgcgtgatcaccgagctcgtgatc
aatcacacgtcggatcagcacccgtggttccagcgcgcgcgccgcgcgaaacccggctcg
aaccaccgcaactactacgtgtggtccgataccgaccagaaatacacgggcacgcgcatt
atcttcatcgataccgagccgtcgaactggacgcacgatcccgtcgcgggcgcgtactac
tggcaccgcttctattcgcaccagcccgacctgaacttcgacaatcccgccgtgctgcgc
gaagtgctgcaggtcatgcgtttctggctcgatatgggcatcgacgggctgcgcctcgac
gcggtgccgtatcttgtcgaacgcgaaggcacgaacaacgagaacctgcccgagacgcac
gccattctgaagaagatccgcgcgacgatcgatgccgagtatccgaaccggatgctgctc
gccgaagccaatcagtggccggaagacgtgcaggaatatttcggcaacgaagacgaatgc
catatggctttccacttcccgctgatgccgcgcatctatatggcaatcgcgagcgaagac
cgctttccgatcaccgacatcatgaaacagacgccggatctcgccgacagttgccagtgg
gcgattttcctgcgcaatcacgatgaactgacgctcgagatggtgaccgactccgagcgc
gattacctgtggaacacgtacgcgaccgatcgccgcgcgcggctcaatctcggcattcgg
cggcgccttgcgccgctgatggaacgcgaccggcgccgcatcgagctgatcaattcgctg
ctgctgtcgatgcccggcacgcccgtcatctactacggcgacgagctcggcatgggcgac
aacatccacctcggcgaccgcgacggcgtgcgcacgccgatgcaatggtcgtccgaccgc
aacggcggcttctcgcgcgcggaccccgaacagctcgtcctgccgcccgtgatgggctcg
ctttacggcttcgacgcggtcaacgtcgaagcgcaaagccgcgatccgcattcgctgctg
aactggacgcgccgcatgctcgcgacgcgccgctcgaagcatgcgttcggtcgcggcacg
atccgcttcctgaagccgagcaatcgcaagattctcgcgtatctgcgcgaaatgccgggc
gagccggcgattctttgcgtcgcgaatctgtcgcgcgcgccgcaggcggtcgaactcgat
ctgtccgaattcgccggcacggtgccggtcgagatgacgtccgattcggtattccccgcg
atcggccagctcagttatctgctgacgtttcctccgtacggcttcctgtggtttctgctg
tgctcgagcaatcagcggccaacgtggagccaggcgccttcggaagcactgcccgatttc
gtcacgatcgtgatccgcgaagggcaggcgggcccgacgccggagaatgtgcgcctgctc
gaatccgaggtgctgccgtcgtggctcgtgcggcggcgctggttcgcatcgaaggaccag
aagctgaacgcggtgcgcctcgccgcactgacgacgattcccgaagccggcttcgccttt
accgaaatcgaagccgatgtcggcaccagcggcaacgaacataccgaacgctatgtgctg
ccgctcgccatcacctggggcgccgacacgacgacgccgcttttcatgcagctcgcactc
gcgcgcgtgcgtcgcgcgcgcaatatcgggcacctgaccgacgcgttcgcgctgccgcaa
ttcgcgtacggcacacttaaaaagctgcgcgagcgagccgccgtgccgaccgtgcagaag
agcgaaatccgctttatcccgaccgaccgcttcgacgagctcgaactcggcgacgcgccc
gaaatccgctggctcgcggccgagcaaagcaacagctcgctcgtgatcgccgacgcgatc
gtgctcaagctcgtgcggcgcctgatgaacggcgtgcatccggaagcggaaatgacgcgc
tatctgacgctgcgcggctatgcgaataccgcgcctttgtatggcgaagtcgtccgcgtc
gacccgcaaggcgtaccgcatacgctgtcgatcctgcaaggctttgtcgacaaccagggc
gatgcgtggaactgggcgctcgattatctgcgccgcacgatcgacgaactcgcgctcgcg
atcgacggcgagccgacgcaggaccgcatcaacgaggaagaggcgttcgacggatattcg
atgtttatcggcatgatcggcaaacggcttggcgaactgcacgtcgtgcttgccgcgcca
tccgacgatccggccttctcgcccgagcctgctacgggcgagcaggtgcgcgcgtggatc
gacggcacgcagtcgatgcttgcggccgcgctcgacgtgctcgaaaggagcaccgagcac
ctgtccgaagactcgctgctgctcgcgcgcagcgtgctcgaccggcgcgaactgctcgtc
gaggctgtcgaaaatctcgtgaacgccgatgcgaacgcgctgtgcacgcgcattcacggc
gatttccatctgggccaggtgctcgtcgcgcaaggcgacgcattcctcatcgacttcgag
ggcgagccggcgcgcagcctcgaggaacgccgcgcgaaatcgagtccgttgcgcgacgtc
gcgggcctcttgcgttcgctgtcgtacgcgagcgccgctgcgcagtcgaccaccgaagcc
gcgccgcaaccgaccgccgatcgcaagcgcgcgctgttcgaccgcttccgcacgcacgcg
gccgaggccttcctcgccgaataccggaaggcgctcgaggcgtcgccgcagcgcatcgtc
gcacccgccgacgagcaggccctgctcgacctgttcctgatcgaaaaggccgcatacgaa
atccgctacgaagcggcgaaccgcccgtcgtggctcggtctgccggtacgcgggctcgcc
gcgctcacgagccggctgctcggcgacacgggcacgcccgccggcagcccgatacagcat
tcaccgggcggcagcgcgccgccgaacgacgccgcagagggcgattatgagtga

DBGET integrated database retrieval system