KEGG   Paraburkholderia sp. SOS3: BTO02_27435Help
Entry
BTO02_27435       CDS       T04966                                 

Definition
(GenBank) phosphoenolpyruvate mutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
para  Paraburkholderia sp. SOS3
Pathway
para00440  Phosphonate and phosphinate metabolism
para01100  Metabolic pathways
para01120  Microbial metabolism in diverse environments
para01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:para00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BTO02_27435
Enzymes [BR:para01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     BTO02_27435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase
Motif
Other DBs
NCBI-ProteinID: APR39086
UniProt: A0A1L6I643
LinkDB All DBs
Position
2:1664452..1666179
Genome map
AA seq 575 aa AA seqDB search
MNAREPSFSATSVTSRSARLRQMLLSSELEFLMEAHNGLSARIVREAGFKAIWGSGLTIS
AQFGVRDNNEASWTQVVDQLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGV
CIEDKQFPKTNSFINGERQPLADVDEFCGKIKAGKDSQLDENFSIVARVEALIAGWGMEE
ALRRAEAYRQAGADAILMHSKLSKPDEILEFAREWAGRGPIVIVPTKYYSTPTDVFRKAG
ISAVIWANHQLRAAVSAMQAVVKDIYEHQTLVNVEDRVATVNEIFRLQDADEYSEAEDRY
LSASRASGSAVVLAASRGKGLEAVTADRPKVMLPIAGKPLLRWLVDAFKKQGVNDITVVG
GYRADAIDTAGIKLVVNEQHETTGELSSLACALDRLQGDTVVSYGDLLFRSYIVRDLVES
EAPFCVVVDSSDASETHAANRSVRDFAWCSASDDRDLFGNKVLLSRVSSDESDAPAGAAS
KAPQGRWVGLMNVRGAGLARLKEVVAQLRTRADFASLDMPALLNALIEAGEEVEVQYVHG
HWRGVNDLEDFRRAGDFAHAQTPLAQAGGADEGAR
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcacgcgaaccttctttctccgccacctcggtcacgtcgcgcagcgcacgcctg
cgccagatgctgctcagcagcgaactcgaattcctgatggaagcgcataacggcctgtcg
gcgcgcatcgtgcgcgaagcgggcttcaaggcgatctggggctccggtctgacgatttcc
gcgcaattcggcgtgcgcgacaacaacgaggcgagctggactcaggtcgtcgatcagctc
gaattcatggccgacgcgagcgacctgccgattctgctcgatggtgacaccggttacggc
aacttcaacaacgtgcgccgccttgtgcgcaagctcgagcagcgcggcatcgcgggcgtg
tgcatcgaagacaagcagtttccgaaaacgaacagctttatcaacggcgaacgccagccg
ctcgcggatgtcgacgaattctgcggcaagatcaaggccggcaaggattcgcagctcgac
gaaaacttttcgatcgtcgcgcgcgtcgaggcgctgatcgcgggctggggcatggaagag
gcgctgcgccgcgccgaagcgtaccggcaagcaggcgccgacgcgatcctgatgcacagc
aagctgtcgaagcccgacgagattctcgagttcgcgcgcgaatgggccggccgcgggccg
atcgtgatcgtgccgaccaagtactacagcacgccgaccgatgtgttccgcaaggccggc
atcagcgcggtgatctgggcgaaccatcagctgcgcgcggccgtgtcggcgatgcaggcg
gtcgtcaaggacatctacgagcaccagacgctcgtcaacgtcgaagatcgcgtggcgacc
gtcaacgagattttccgtctgcaggacgcggacgaatattcggaagcggaagaccgctac
ctgtccgcctcgcgcgcatcgggctcggctgtcgtgctcgcggcgagccgcggcaagggt
ctcgaagccgtcacggccgaccgtccgaaggtcatgctgccgatcgccggcaagccgctg
ttgcgctggctcgtcgatgcgttcaagaagcagggtgtcaacgacatcacggtggtcggc
ggttatcgcgccgacgcgatcgacacggccggtatcaagctcgtcgtgaacgaacagcac
gaaacgacgggcgagctctcgtcgctggcctgcgcgctcgatcgtctgcagggcgatacg
gttgtctcatacggcgatctgctgttccgcagctatatcgtgcgcgacctcgtcgaaagc
gaagcgccgttctgcgtcgtcgtcgattcgtcggatgcgtcggaaacgcatgcggccaac
cgcagcgtgcgcgatttcgcatggtgttcggcgtcggacgaccgtgacctgttcggcaac
aaggtgctgctgagccgcgtgtcgagcgacgagagcgatgcgccggccggcgcggcgtcg
aaggcgccgcaaggccgctgggtcgggctcatgaacgtgcgcggcgcgggtctcgcgcgc
ctcaaggaagtggtggcgcaactgcgcacgcgtgcagactttgcgtcgctcgacatgccg
gcgctgctcaatgcgctgatcgaagcgggcgaagaggtcgaagtgcaatacgtgcacggc
cactggcgcggcgtcaacgatctcgaagacttccgccgcgccggcgatttcgcgcacgcg
cagacgccgctcgcacaagctggcggcgcagacgagggcgcacgatga

DBGET integrated database retrieval system