KEGG   Paraburkholderia sp. SOS3: BTO02_27435
Entry
BTO02_27435       CDS       T04966                                 

Definition
(GenBank) phosphoenolpyruvate mutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
para  Paraburkholderia sp. SOS3
Pathway
para00440  Phosphonate and phosphinate metabolism
para00998  Biosynthesis of various secondary metabolites - part 2
para01100  Metabolic pathways
para01110  Biosynthesis of secondary metabolites
para01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:para00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BTO02_27435
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    BTO02_27435
Enzymes [BR:para01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     BTO02_27435
SSDB
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase
Other DBs
NCBI-ProteinID: APR39086
UniProt: A0A1L6I643
LinkDB
Position
2:1664452..1666179
AA seq 575 aa
MNAREPSFSATSVTSRSARLRQMLLSSELEFLMEAHNGLSARIVREAGFKAIWGSGLTIS
AQFGVRDNNEASWTQVVDQLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGV
CIEDKQFPKTNSFINGERQPLADVDEFCGKIKAGKDSQLDENFSIVARVEALIAGWGMEE
ALRRAEAYRQAGADAILMHSKLSKPDEILEFAREWAGRGPIVIVPTKYYSTPTDVFRKAG
ISAVIWANHQLRAAVSAMQAVVKDIYEHQTLVNVEDRVATVNEIFRLQDADEYSEAEDRY
LSASRASGSAVVLAASRGKGLEAVTADRPKVMLPIAGKPLLRWLVDAFKKQGVNDITVVG
GYRADAIDTAGIKLVVNEQHETTGELSSLACALDRLQGDTVVSYGDLLFRSYIVRDLVES
EAPFCVVVDSSDASETHAANRSVRDFAWCSASDDRDLFGNKVLLSRVSSDESDAPAGAAS
KAPQGRWVGLMNVRGAGLARLKEVVAQLRTRADFASLDMPALLNALIEAGEEVEVQYVHG
HWRGVNDLEDFRRAGDFAHAQTPLAQAGGADEGAR
NT seq 1728 nt   +upstreamnt  +downstreamnt
atgaatgcacgcgaaccttctttctccgccacctcggtcacgtcgcgcagcgcacgcctg
cgccagatgctgctcagcagcgaactcgaattcctgatggaagcgcataacggcctgtcg
gcgcgcatcgtgcgcgaagcgggcttcaaggcgatctggggctccggtctgacgatttcc
gcgcaattcggcgtgcgcgacaacaacgaggcgagctggactcaggtcgtcgatcagctc
gaattcatggccgacgcgagcgacctgccgattctgctcgatggtgacaccggttacggc
aacttcaacaacgtgcgccgccttgtgcgcaagctcgagcagcgcggcatcgcgggcgtg
tgcatcgaagacaagcagtttccgaaaacgaacagctttatcaacggcgaacgccagccg
ctcgcggatgtcgacgaattctgcggcaagatcaaggccggcaaggattcgcagctcgac
gaaaacttttcgatcgtcgcgcgcgtcgaggcgctgatcgcgggctggggcatggaagag
gcgctgcgccgcgccgaagcgtaccggcaagcaggcgccgacgcgatcctgatgcacagc
aagctgtcgaagcccgacgagattctcgagttcgcgcgcgaatgggccggccgcgggccg
atcgtgatcgtgccgaccaagtactacagcacgccgaccgatgtgttccgcaaggccggc
atcagcgcggtgatctgggcgaaccatcagctgcgcgcggccgtgtcggcgatgcaggcg
gtcgtcaaggacatctacgagcaccagacgctcgtcaacgtcgaagatcgcgtggcgacc
gtcaacgagattttccgtctgcaggacgcggacgaatattcggaagcggaagaccgctac
ctgtccgcctcgcgcgcatcgggctcggctgtcgtgctcgcggcgagccgcggcaagggt
ctcgaagccgtcacggccgaccgtccgaaggtcatgctgccgatcgccggcaagccgctg
ttgcgctggctcgtcgatgcgttcaagaagcagggtgtcaacgacatcacggtggtcggc
ggttatcgcgccgacgcgatcgacacggccggtatcaagctcgtcgtgaacgaacagcac
gaaacgacgggcgagctctcgtcgctggcctgcgcgctcgatcgtctgcagggcgatacg
gttgtctcatacggcgatctgctgttccgcagctatatcgtgcgcgacctcgtcgaaagc
gaagcgccgttctgcgtcgtcgtcgattcgtcggatgcgtcggaaacgcatgcggccaac
cgcagcgtgcgcgatttcgcatggtgttcggcgtcggacgaccgtgacctgttcggcaac
aaggtgctgctgagccgcgtgtcgagcgacgagagcgatgcgccggccggcgcggcgtcg
aaggcgccgcaaggccgctgggtcgggctcatgaacgtgcgcggcgcgggtctcgcgcgc
ctcaaggaagtggtggcgcaactgcgcacgcgtgcagactttgcgtcgctcgacatgccg
gcgctgctcaatgcgctgatcgaagcgggcgaagaggtcgaagtgcaatacgtgcacggc
cactggcgcggcgtcaacgatctcgaagacttccgccgcgccggcgatttcgcgcacgcg
cagacgccgctcgcacaagctggcggcgcagacgagggcgcacgatga

DBGET integrated database retrieval system