KEGG   Paraburkholderia sp. SOS3: BTO02_29000Help
Entry
BTO02_29000       CDS       T04966                                 

Definition
(GenBank) amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
para  Paraburkholderia sp. SOS3
Pathway
para00970  Aminoacyl-tRNA biosynthesis
para01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:para00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BTO02_29000
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:para03029]
    BTO02_29000
Enzymes [BR:para01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BTO02_29000
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BTO02_29000
Mitochondrial biogenesis [BR:para03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BTO02_29000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: APR39335
UniProt: A0A1L6I764
LinkDB All DBs
Position
2:1990643..1992007
Genome map
AA seq 454 aa AA seqDB search
MNDTRMKPSTALAMAQAFAQGSADPVAVTAIALEQARSRRTTFISVVAADRALKQAEEAA
ERWRRKMPLSVLDGVPIAWKDLFDLAGLATTAGSATGAANAPAAANAALVARAEQAGMIS
VGKTNLSEFAYSGLGLNPHFGTPTNPDIDHGLRVPGGSSSGAAIAVATAVVPISVGTDTA
GSIRIPSAFNGLTGYRASIGRYSRAGMVGLSGTLDTIGPIANTVCDCVAFDAVVQGVPFR
NANRGLHNERFVIDSSLFERYAVSDAVASRFTAFIERLRESGARVDECAFAALAEVHRVI
AAKGWIGAIEAFETHRALLDSEAAATLDARVRDRLELARHVPSSRRGELLALRERLQAMF
ARELQEATLIVPTVGHTPPLLAPLEADPELFAAVNMKTLAMTMPASFLDAPVVAMPSGAD
GHSLPTGVQLIRRSNDDDTLLSIAQQVERHMQAC
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacacgcgcatgaaaccctctacggcgctcgccatggcgcaggcgttcgcacag
gggagcgccgatccggttgccgtgacggccatagcgctcgagcaggcgcgcagcagacgc
acgactttcatttcggtagtcgccgcggatcgggcattgaaacaggcggaagaagcggct
gaacgctggcgccggaaaatgccgctcagcgtgctcgatggcgtgccgatcgcgtggaaa
gacctcttcgatcttgccgggctcgccaccacggcgggttctgcgacgggggccgcaaac
gcgccggcagcggcgaatgcagcgctcgtcgcacgggccgaacaggccggcatgatctcc
gtgggcaagacgaacctcagcgaattcgcctattcgggattgggcctgaatccgcatttc
ggtacgccgaccaaccccgatatcgatcatggcctgcgcgtgccgggcgggtcttcgtcg
ggcgcggcaattgccgttgcaacggcagtcgtgccgatttccgtcgggaccgatacagcc
ggctcgatccggattccttcggcattcaacggccttaccggttacagggccagcatcggc
cgttattcacgtgcgggaatggttggcctttcgggcacactcgacaccatcggccccatt
gcgaacacggtgtgcgattgcgtcgcgttcgacgccgtggtgcaaggcgtgccttttcgc
aacgcaaaccgtggtttgcacaacgagcgattcgtcatcgactcttcgctattcgaacga
tatgcggtgtccgatgcagtcgcgtcgcgcttcactgcgtttatcgaacgcttgcgggaa
agtggcgcacgcgtcgacgagtgtgcgtttgcggcgctcgccgaagttcatcgggtcatt
gcagcgaagggatggatcggtgcgatcgaggcgttcgaaacgcatcgagccttgcttgac
tcggaggccgcggccacgctcgatgcgcgtgtgcgcgatcgccttgaacttgcccggcat
gttccatcgtcacggcgcggcgaactgctggcgctaagagagcggctgcaagcgatgttt
gcgcgcgagttgcaggaggcgaccttgatcgtgccgacggtcggccacacgccaccgttg
ctcgcgccgctcgaggcggacccggagctgttcgcggcggtcaatatgaaaacactggcg
atgacgatgcccgcaagctttctcgatgcgccggtcgtcgccatgccgtcgggcgccgac
ggccattccctgccgaccggcgtccagctgatccgtcgctcgaacgacgatgacacgttg
ttgagcatcgcacagcaggtagagcggcacatgcaagcttgctga

DBGET integrated database retrieval system