KEGG   Paraburkholderia sp. SOS3: BTO02_29085Help
Entry
BTO02_29085       CDS       T04966                                 

Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
para  Paraburkholderia sp. SOS3
Pathway
para00250  Alanine, aspartate and glutamate metabolism
para00410  beta-Alanine metabolism
para00640  Propanoate metabolism
para00650  Butanoate metabolism
para01100  Metabolic pathways
para01120  Microbial metabolism in diverse environments
Module
para_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:para00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BTO02_29085
   00650 Butanoate metabolism
    BTO02_29085
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BTO02_29085
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BTO02_29085
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:para01007]
    BTO02_29085
Enzymes [BR:para01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BTO02_29085
Amino acid related enzymes [BR:para01007]
 Aminotransferase (transaminase)
  Class III
   BTO02_29085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: APR39350
UniProt: A0A1L6I841
LinkDB All DBs
Position
2:complement(2008704..2009996)
Genome map
AA seq 430 aa AA seqDB search
MSTANSELQQRKDAATPRGVGVMCDFYAERALNAQLWDVEGRRFIDFAAGIAVTNTGHRH
PKIVAAIREQLDRFTHTAYQVVPYRSYVELAEKINARTPGKHAKKTAFFTTGAEAVENAV
KIARAATGRPGVIAFTGAFHGRTMMGMALTGKVAPYKLGFGPFPPDVFHAPFPTPLHGVT
TADSLKALEHLFKADIDPQRVAAIIFEPVQGEGGFHPAPAEFVRGLRALCDTHGMLLIAD
EVQTGFARTGKLFAMEHYDVVPDLMTMAKSLAGGMPLSGVTGRAEIMDAAAPGGLGGTYA
GNPLAVAAAHAVLDIIDSEALCDRAALLGERLKATLKELRAAVPQIADVRGPGAMIAVEF
GKQGAAHEPDAAFTKRVQSRALERGLLLLVCGVHSNVIRFLFPLTIEDHVFDEAIAILED
VLKETASDVE
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccgccaattccgaactgcaacagcgtaaagacgccgcgacgccccgcggcgtc
ggtgtgatgtgcgacttctacgccgagcgcgcgctcaatgcgcagttgtgggatgtcgaa
ggccgccgcttcatcgacttcgcggccggcatcgcggtgaccaacaccggccatcgtcat
ccgaaaatcgtcgcggcgattcgcgagcagctcgatcgcttcacgcacacggcgtatcag
gtcgtgccgtaccgctcgtatgtcgaactcgccgaaaagatcaacgcgcgcacgcccggg
aagcacgcgaaaaagaccgcgtttttcacgaccggcgccgaagcggtcgagaacgcggtg
aagatcgcccgcgccgccaccggccgcccgggggtgatcgcgttcaccggcgcgtttcac
ggccgcacgatgatgggcatggcgctgaccggcaaggtcgcaccgtacaagctcggcttc
gggccatttccgcccgatgtctttcacgcgccgttcccgaccccgctgcacggcgtcacg
acggccgattcgctgaaggcgctcgagcatctgttcaaggccgacatcgatccgcagcgc
gtcgcagcgatcattttcgagcccgtgcagggcgaaggcggattccacccggcgccggcg
gaattcgtgcgcggcctgcgcgcgctgtgcgatacgcacggcatgctgctgatcgccgac
gaagtgcaaaccggctttgcgcgcacgggcaagctgttcgcgatggaacactacgacgtc
gtgcccgacctcatgacgatggccaagagcctcgccggcggtatgccgctatcgggcgtg
acgggccgcgccgagatcatggacgcggcggcgccgggcggactcggcggcacctacgcg
ggcaacccgctcgccgtcgcggccgcgcatgcggtgctcgacatcatcgatagcgaggcg
ctgtgcgatcgcgcggctttgctcggcgaacgcctgaaggccacactgaaagaacttcgc
gcagcggtgccgcaaatcgccgatgtacgcggcccgggcgcgatgatcgcggtcgagttc
ggcaagcaaggcgccgcgcacgagcccgatgcggcgttcacgaagcgcgtgcagtcgcgc
gcgctcgagcgcggcctgctgctgctcgtgtgcggtgtccattcgaacgtgattcgcttc
ctgtttccgctcaccatcgaggaccacgtgttcgacgaagccatcgccattctcgaagac
gtgctgaaggaaaccgcaagcgacgtcgagtga

DBGET integrated database retrieval system