KEGG   Paraburkholderia aromaticivorans: CJU94_13770Help
Entry
CJU94_13770       CDS       T05169                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
Organism
parb  Paraburkholderia aromaticivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: ASV99128
UniProt: A0A248VJG3
LinkDB All DBs
Position
1:3005517..3006941
Genome map
AA seq 474 aa AA seqDB search
MKTYDQLYIDGKWIAPSGTSTIDVIDSGTEEIMGRIPAGIEADAESAIAAARVAFDGWAA
TPAAGRGEFLRKIAANLKARTDELASLIAGEVGMPLKLARAIQVGGPVYNWGAYAKLASE
FQYEERVGNSLVVREPVGVVAAITPWNYPLNQVTLKVAAALAAGCTVVLKPSEIAPLNAF
VLAEAIHEAGLPAGVFNLVSGYGPVVGEMLASHPSVDMVSFTGSTRAGKRVSELASATVK
RVALELGGKSASVILDDADFAAAVKGTVSACFLNSGQTCSAHTRMLVPETRYDEARALAK
QVAETYVAGDPRHETTRLGPLASAAQQARVLHYIAKGIEEGAELVTGGAGLPDGVSKGFF
VKPTVFGRVHPKATIAQEEIFGPVLSILTYKDEEEAVRIANDSPYGLGGAVWAGSDERAV
GIARRIRTGQVDINGGAWNMAAPFGGFKQSGFGRENGVYGLEEYLELKSMQFKA
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaagacctacgaccaactctatatcgacggcaagtggatcgcgccgagcggcacgagc
acgatcgacgtgatcgactcgggcacggaagagatcatgggccgcatccccgcaggtatc
gaggccgacgccgaaagcgcgatcgccgccgcgcgcgtcgcgttcgacggctgggccgcc
acgcccgccgccgggcgtggcgagtttctgcgcaaaatcgcggcgaacctgaaagcgcgc
accgacgaactggccagtttgatcgccggcgaggtcggcatgccgctcaagctcgctcgc
gcgattcaggtgggcggtcctgtctacaactggggcgcgtatgcgaagctcgcgagcgag
ttccagtatgaggaacgcgtcggcaattcgctggtggtgcgcgagccggtcggcgtggtg
gcggcgatcacgccgtggaactatccgctcaatcaggtcacgctgaaggtcgcggcggcg
ctcgccgccggttgcacggtggtgctcaagccctcggagatcgcgccgctgaacgcgttc
gtgcttgccgaggcgatccacgaggccgggctgccggccggcgtgttcaacctggtgagc
ggttatgggccggtggtgggcgaaatgctggcgagccatccgtcggtcgacatggtgtcg
tttaccggctcgacgcgcgcgggaaaacgggtgtccgagctggcgtcggcgacggtcaaa
cgcgtggcgctcgaactcggcggcaagtcggcgtcggtgattctcgacgatgcggatttc
gccgcggcggtcaagggcacggtcagcgcgtgtttcctgaattccggacaaacatgctcg
gcgcacacgcgcatgctggtgcccgagacgcgttacgacgaagcgcgcgcgctggcgaag
caggtcgccgagacatacgtggcgggcgacccgcgccatgaaacgacccgtctcggcccg
ctggcgtcggcggcgcagcaggcgcgcgtgctgcactacatcgcgaagggaatcgaggag
ggcgccgagctggtgacggggggcgcgggcttgcctgacggggtgtcgaagggcttcttc
gtcaaacccaccgtgttcggccgcgtgcatcccaaggcgacgatcgctcaggaggaaatc
ttcggcccggtcctgtcgattctcacctacaaggacgaagaggaagcggttcggattgcc
aatgattcgccgtatggcctcggcggcgcggtatgggccggcagcgacgagcgtgcggtc
ggcatcgcgcggcggatccggaccggtcaggtggatatcaatggcggtgcatggaacatg
gccgcgccgttcggcggcttcaagcagtcgggattcgggcgcgagaacggcgtctatgga
ctcgaagagtatctcgaactcaagtccatgcaattcaaggcgtga

DBGET integrated database retrieval system