KEGG   Paraburkholderia aromaticivorans: CJU94_14485
Entry
CJU94_14485       CDS       T05169                                 

Definition
(GenBank) type VI secretion system-associated lipoprotein
  KO
K11906  type VI secretion system protein VasD
Organism
parb  Paraburkholderia aromaticivorans
Pathway
parb03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:parb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    CJU94_14485
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:parb02044]
    CJU94_14485
Secretion system [BR:parb02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   CJU94_14485
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: ASV99253
UniProt: A0A248VJP6
LinkDB
Position
1:complement(3173584..3174096)
AA seq 170 aa
MRLFTHVIALALAFVFACALSACASGETKTDKAALKLDLSVVASAGVNPDDQKRAAPIVI
RVYELKTDGAFTSADFFSLQDKDKTVLADDLVTRAQFQLRPGESKTIRTRADPATTVVGV
LAAYRDLPNSVWRAVYPLPAAPRAVWYRASPELKLTIDLEPNAIRITETK
NT seq 513 nt   +upstreamnt  +downstreamnt
atgcgcctgttcacccacgttattgccctcgccctcgcctttgtctttgcctgtgcgctg
agcgcgtgcgccagcggcgaaacgaaaaccgataaagcagccctcaagctcgacctgtcg
gttgtcgcgtccgccggtgtcaatccagacgaccagaagcgcgcggcgccgatcgtcata
cgcgtctatgaattgaaaaccgatggcgcattcacttccgccgactttttttccttgcag
gacaaggacaagaccgtcctcgccgacgacctcgtcacgcgggcgcagttccagttgcgg
cccggcgagagcaaaaccatccggacgagagccgatcctgccacgaccgtcgtcggggta
ctcgcggcctatcgggatctgcccaactcggtatggcgcgcggtctatccgctgccggcg
gcgcccagggcggtgtggtatcgcgcctcgcccgaactgaaactgacgatcgatcttgaa
ccgaatgcaatcaggattaccgagactaaatag

DBGET integrated database retrieval system