KEGG   Paraburkholderia aromaticivorans: CJU94_14955Help
Entry
CJU94_14955       CDS       T05169                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
parb  Paraburkholderia aromaticivorans
Pathway
parb00010  Glycolysis / Gluconeogenesis
parb00620  Pyruvate metabolism
parb01100  Metabolic pathways
parb01110  Biosynthesis of secondary metabolites
parb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:parb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CJU94_14955
   00620 Pyruvate metabolism
    CJU94_14955
Enzymes [BR:parb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     CJU94_14955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA LuxC
Motif
Other DBs
NCBI-ProteinID: ASV99331
UniProt: A0A248VLE1
LinkDB All DBs
Position
1:3286430..3287950
Genome map
AA seq 506 aa AA seqDB search
MNHADMQFLDVEFPYARQYANFIGGEWVPPVRGEYFDNVSPITGEPFTSIPRSTEEDIEL
ALDAAHRARQAWADTAPAVRATILNRIADRMEQNLSRIAFAESIDNGKPIRETLAADIPL
AIDHFRYFAGCIRAQEGTLSEIDADTVAYHFHEPLGVVGQIIPWNFPILMAVWKVAPALA
AGNCIVLKPAEQTPASILVLIELIQDLLPPGVLNVVNGFGLEAGKPLASSKRIAKIAFTG
ETSTGRLIMQYASQNIIPVTLELGGKSPNIFFADVTNEDDGYFDKALEGFAMFALNQGEV
CTCPSRVLIDEKIYDRFMERALKRVAAIAQGHPLDTKTMIGAQASQEQLEKILSYIDLGK
QEGAECLIGGERNTLGGELSKGYYVKPTVFRGNNKMRIFQEEIFGPVVSVTTFKTEEEAL
EIANDSLYGLGAGVWTRDGTRAYRFGRQIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRET
HKMMLDHYQQTKNLLVSYSNQPLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacgcagatatgcagtttctcgacgtcgaatttccgtatgcgcggcagtacgcc
aatttcatcggcggcgaatgggttccgccggtgcggggcgagtacttcgacaacgtgtcg
ccgatcacgggcgaaccctttacgtcgatcccgcgttcgacggaagaagatatcgaactc
gcgctggatgcggcgcaccgcgcgcgccaggcgtgggccgatacggcgcctgccgtgcgc
gcgacgatcctgaaccgtatcgcggatcgcatggagcagaacctgtcgcgcatcgcgttt
gccgaatcgatcgacaacggcaagccgatccgcgaaacgctcgccgccgacattccgctc
gcgatcgaccacttccgctatttcgccggctgcattcgcgcccaggaaggaaccctctcc
gagatcgatgcggataccgtggcttatcattttcatgagccactgggcgtggtcggtcag
atcattccgtggaatttcccgatcctgatggccgtgtggaaggtcgcgcccgcactggcc
gccggaaactgcatcgtattgaagcctgcggagcaaacccccgcgtcgatcctcgttctg
atcgaactgattcaggatttgctgccgccgggtgtgctgaatgtggtcaacgggttcggt
ctcgaagccggcaaaccgctggcatcgagcaagcgcatcgccaagatcgcgtttaccggt
gagacttcgaccggtcgtctgatcatgcagtatgcgagccagaacatcattcccgtcacg
ctcgaactcggcggtaaaagcccgaatattttcttcgccgatgtgacgaatgaggacgac
ggctatttcgacaaggcgctcgaaggctttgcgatgtttgcgctgaatcagggcgaagtg
tgcacgtgtccgtcgcgcgtattgatcgatgaaaagatctacgaccgcttcatggagcgt
gcgctcaagcgcgttgcggcgattgcgcaagggcatccgctcgataccaaaacgatgatc
ggcgcgcaggcctcgcaggaacagcttgaaaagattctttcgtatatcgatctcggcaaa
caggaaggcgccgagtgtctgattggcggtgaacgcaatacgctgggcggtgagttgagc
aaaggctattacgtgaagccgacggtatttcgcggcaacaacaagatgcgcatctttcag
gaggagatcttcggacctgtggtatcggtcacgacgttcaagaccgaagaagaagcgctc
gaaatcgccaacgattcgctctacggtctcggcgcgggcgtgtggacgcgcgacggcaca
cgtgcctatcgcttcggccggcagattcaggcaggccgcgtgtggaccaattgttaccac
gcctatccggcgcatgcggcgttcggcggttataaacagtccggcattggccgcgaaacc
cacaagatgatgctcgaccactatcagcagaccaagaatctgctcgtgagctatagcaac
cagccgttgggtttcttctaa

DBGET integrated database retrieval system