KEGG   Paraburkholderia aromaticivorans: CJU94_15695Help
Entry
CJU94_15695       CDS       T05169                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
parb  Paraburkholderia aromaticivorans
Pathway
parb00061  Fatty acid biosynthesis
parb00780  Biotin metabolism
parb01100  Metabolic pathways
parb01130  Biosynthesis of antibiotics
parb01212  Fatty acid metabolism
Module
parb_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:parb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CJU94_15695
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CJU94_15695
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CJU94_15695
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:parb01004]
    CJU94_15695
Enzymes [BR:parb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     CJU94_15695
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     CJU94_15695
Lipid biosynthesis proteins [BR:parb01004]
 Fatty acid synthase
  Component type
   CJU94_15695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: ASV99460
UniProt: A0A248VKF6
LinkDB All DBs
Position
1:complement(3475629..3476411)
Genome map
AA seq 260 aa AA seqDB search
MPIEQPRLILKDAKALVTGIANEHSIAYGCAKAFHELGASLAITYANDKAKPYVEPLAKS
LDAQVFMPLDVTREGELEAVFGRVDELWGQLDIVVHAIAWAPTADLHGGLLNSSCEGFLS
AMDISCHSFVRMARLAAPLMKEGGTLLTMSYYGANKVVPNYSVMGPVKAALEACTRYLAH
ELGPKGIRVHAISPGPLKTRAASGLKDFELMLNEAVQRAPLGEVVDIMDVGYTCAFLATP
YARRLSGETLYIDGGLNIMA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcgagcaaccgcgtttgattctgaaagatgcgaaagcgctagtcacgggcatt
gccaacgaacactcgattgcctacggatgcgcgaaggcttttcatgaacttggggcaagc
ctcgcgatcacctacgcgaacgacaaggcgaagccttacgtggagccgctcgcaaaatcg
ctcgatgcgcaggttttcatgccgctggacgtgacgcgggagggcgagctcgaagccgtc
ttcgggcgagtcgacgaactgtgggggcaactcgacatcgtcgtgcacgccatcgcctgg
gcgccgacggcggatctgcacggcggcctgttgaattcttcgtgcgagggctttctgagc
gcgatggatatttcgtgccactcgttcgtgcgcatggcgcgccttgccgcgccgctgatg
aaagagggcggtacgttgttgacgatgagctattacggtgcgaacaaggtggtgccgaac
tacagcgtgatgggtcccgtcaaagccgctcttgaagcctgcacgcgatatctggcgcac
gaactcgggccgaagggcatccgcgtgcacgccatttcgcccggcccgctcaaaacgcgc
gcggcgtccgggctgaaggatttcgaactgatgttgaacgaagccgtgcagcgtgcgcct
ctgggcgaggtggtcgacatcatggacgtggggtacacctgcgcatttctggccacgccg
tacgcgcggcggctatccggcgagacgttgtatatcgacgggggcctgaacatcatggcg
tga

DBGET integrated database retrieval system