KEGG   Paraburkholderia aromaticivorans: CJU94_15880Help
Entry
CJU94_15880       CDS       T05169                                 

Gene name
ligD
Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
parb  Paraburkholderia aromaticivorans
Pathway
parb03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:parb00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    CJU94_15880 (ligD)
Enzymes [BR:parb01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CJU94_15880 (ligD)
DNA repair and recombination proteins [BR:parb03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     CJU94_15880 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ASV99494
UniProt: A0A248VKX1
LinkDB All DBs
Position
1:complement(3518242..3521415)
Genome map
AA seq 1057 aa AA seqDB search
MNDRLDTYNRKRRFDETPEPSGARASRKQGSRKTTARASAEALSYVIQEHDARRLHYDFR
LELNGTLLSWAVPKGPSLDPSVKRLAVHVEDHPVEYGSFEGEIPPGNYGAGSVIVWDRGT
WEPVGGAAEAARAYAAGKLKFLLHGDKLHGGWTLVRSHMRGSGDKEQWLLIKERDDEARA
ESEYDILKKRPGSVLDGSAPAGKGARTSRTVTASRTTGKAVRKAVAPAQASTDPDAASQS
KRAGKPGAKRASPNRADPARADIVVTRSAQSLRELAASPAIEGAVPARLPATFKPQLATL
VDTAPPGADWSYEIKFDGYRVLVRIDRTTRGNPVKVFTRAGNDWTAKFSKKVKAFEQLEI
DSAWLDGEAVVLDPNGVPNFQALQNAFDSNRPQDIVIYLFDIPFLNGYDLRGVPLEQRRA
ILRALLEEVDDSVLRFSNHFDFSADHLLRSACDMALEGIIGKRRDSGYMSGRSSAWIKLK
CRRRQEFVIGGYSEPSGSRAAFGALLLGVYDGNGQLQYAGRVGTGFDAALLRSVKQELDA
HESRHMPFAAAPRERSRTPVHWVEPVLVAECNFAEWTSDGIVRQASFVSLRNDKPARQIV
KETPRQGADVQQQTDSLSDDPPKKRGARKTSGSAAAGAGAEEAGAASTAGTAASKAAGAK
SASGKATAGAEATSAKATSANATGAKATSAKATSAKATSAKATSAKATSAKKAISAEATG
TKKTAASKSMASKSMATKSTATQASATTQNAATKSNATQIPAEVAGVRISHPERVMDSSS
GTRKIALVQYYEAVADWMLPHLQDRPVSLVRAPEDIGGELFFQKHSQKLSIPNVTQHPDL
DPGHPPLITVDTLKALVGAAQMGTVEFHTWNAVVSNIEKPDRMVFDLDPDASLGWERMIE
AAQMTRSLLEELGLTSFCKTSGGKGLHVVVPLAKQAGWDEVKDFSQAVAQHMAATLPKYF
SAKMGAQNRKQKIFVDYLRNNRGSSTVAAFSARARPGLGVSVPLTWDEVAATTGGDQWTI
ENLHERLADLKSDPWADYAKTRQRITAAMKKRLDGAR
NT seq 3174 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaccgactcgacacctacaaccgcaaacgccgcttcgacgaaacgccggagccc
tcgggcgcgcgcgcgagccgcaaacagggcagccggaagacgaccgcacgggcatccgcc
gaggcgctctcctacgtgattcaggagcatgacgcgcgccgtttgcactacgacttccgg
ctcgaactgaacggcacgctgctgtcatgggcggtgccgaaggggccgagcctggacccg
tcggtgaaacggcttgcggtgcatgtcgaggaccatccggtcgaatacggttccttcgaa
ggggagattccaccgggcaattacggcgcgggcagcgtgatcgtgtgggaccgcggcacg
tgggaaccggttggcggggcggcggaggcggcgcgcgcctacgcggccggcaaactcaag
ttcctgttgcacggcgacaagctgcacggcggctggacgctagtgcgcagccatatgcgc
ggcagcggcgacaaggagcaatggctgctcatcaaggagcgcgacgacgaggcgcgcgcc
gagagcgagtacgacatattgaagaagcgcccgggcagtgtgctcgacggcagcgccccg
gcgggcaaaggcgcgagaacgtcgaggaccgtcacagccagccgcacgaccggaaaggcg
gtgcgcaaagctgtcgcgcctgcgcaagccagcacggacccggacgcggcgtcccagtcg
aaacgagccggcaagcccggcgcgaagcgcgcttcaccgaaccgtgccgaccccgcgcga
gccgatatcgtcgtgactcgcagcgcgcagtcgctgcgcgaactcgccgcttcgcccgcc
atcgagggtgcggtgccggcccgcttgcccgcgacgttcaaaccgcaactggcgacgctc
gtcgacaccgcgcctcccggcgccgattggtcgtatgaaatcaagttcgacggttatcgc
gtgctggtccgaatcgacaggacgacgcggggaaacccggtcaaggtgttcacccgcgcc
ggcaatgactggaccgcgaagttcagcaaaaaggtcaaggcgttcgaacaactcgagatc
gacagcgcgtggctcgatggcgaagccgtcgtgctggacccgaacggcgttccgaatttt
caggcgctgcaaaacgctttcgattcgaaccgtccgcaggacattgtgatctacctgttc
gacataccttttctgaacggctacgacttgcgcggcgtgccgctcgaacagcgccgcgcg
attctgcgcgcgctgctggaagaggtcgacgacagcgtgttgcgcttctcgaaccacttc
gacttcagcgccgaccacctgctcaggagcgcatgcgacatggcgctggaaggcatcatc
ggcaagcgtcgcgatagcggctacatgtcgggacgctcgtccgcatggatcaagctgaag
tgccgccgacgccaggagttcgtgatcggcggctattcggaaccgtccggcagccgcgcg
gcattcggtgcgctgctgctcggtgtctacgacggcaacggccaattgcagtacgcgggg
cgggtgggcaccggtttcgacgcggcgctgttgcgctcggtgaagcaggagctcgacgcg
cacgagagccggcacatgccgttcgcggccgcgccgcgcgagcgcagccgcacgccggtg
cattgggtcgaaccggtgctcgtcgccgaatgcaatttcgcggaatggacgagcgacggc
atcgtgcgtcaggcgtcgttcgtgagtctgcgcaacgacaagccggcgcgtcagatcgtc
aaggaaacacctcgccagggagccgacgtgcaacagcaaaccgattctttgtccgacgac
ccgccgaagaagcgcggggcgcggaaaacttccgggagcgctgcggctggggctggggcg
gaagaagcgggggcagcgagcacggcgggaacggcggccagtaaggcagcgggcgcaaaa
agcgcgagcggcaaggccaccgccggcgctgaagctactagtgccaaggctactagcgcc
aatgccaccggtgccaaagctaccagcgccaaagcgaccagtgccaaagcgactagcgca
aaagccactagcgcaaaagccactagcgcaaaaaaagccatcagcgccgaagctaccggc
acaaaaaaaacggccgccagcaaatccatggccagcaaatccatggccaccaaatccacg
gccacccaagcctctgccaccacgcaaaacgcagcgacaaaatcaaacgccacacagatt
cccgctgaagtcgcgggcgtgcgcatctcccaccccgagcgcgtcatggactcaagcagc
ggcacgcgcaagatcgctctcgtgcagtactacgaagcggtcgccgactggatgctgccg
catctgcaggatcgcccggtgtcgctggtgcgcgcaccggaggacatcggcggtgaattg
ttcttccagaagcacagccagaagctgtcgattccgaacgtgacccagcatcccgacctc
gatccgggtcatccgccgctgatcaccgtcgacacgctcaaggcgctggtcggcgccgcg
cagatgggcaccgtcgaatttcacacgtggaacgcggttgtgtcgaacatcgaaaagccg
gaccgcatggtgttcgacctcgaccccgacgcgtcgcttggctgggagcgcatgatcgag
gccgcgcaaatgacccgttcgctgctcgaagaactcggcctcacgtcgttctgcaagacg
agcggcggcaagggcctgcacgtggtcgtgccgctcgcgaaacaggccggctgggacgaa
gtgaaggatttttcgcaagccgtcgcgcagcacatggcggcgacgctgcccaagtacttc
agcgcgaagatgggcgcgcagaatcgcaagcagaaaattttcgtcgactacctgcgcaac
aaccgcggttcgagtacggtcgccgcgttctcggcgcgtgcgcggccgggcctgggcgta
tcggtgccgctgacgtgggacgaagtcgccgccaccacgggcggcgatcaatggaccatc
gagaatctgcacgaacgcctcgccgacctcaagagcgacccgtgggcggactatgcaaag
acgcgccagcgcattaccgccgccatgaagaaacgcctggacggcgcacggtaa

DBGET integrated database retrieval system