KEGG   Paraburkholderia aromaticivorans: CJU94_16915Help
Entry
CJU94_16915       CDS       T05169                                 

Definition
(GenBank) dihydrolipoyllysine-residue succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
parb  Paraburkholderia aromaticivorans
Pathway
parb00020  Citrate cycle (TCA cycle)
parb00310  Lysine degradation
parb00380  Tryptophan metabolism
parb01100  Metabolic pathways
parb01110  Biosynthesis of secondary metabolites
parb01120  Microbial metabolism in diverse environments
parb01130  Biosynthesis of antibiotics
parb01200  Carbon metabolism
Module
parb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
parb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:parb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CJU94_16915
  09105 Amino acid metabolism
   00310 Lysine degradation
    CJU94_16915
   00380 Tryptophan metabolism
    CJU94_16915
Enzymes [BR:parb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CJU94_16915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ASV99674
UniProt: A0A248VLE4
LinkDB All DBs
Position
1:complement(3736657..3737943)
Genome map
AA seq 428 aa AA seqDB search
MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIEIETDKVVLEVPAPSAGVLAQV
IANDGDTVTADQVIAKIDTEGTASAAAVEAEVKPAPQAAPAPAAAPAPVAQAASATGANT
AASPAAGKLMAEKGLGAGDVAGTGRDGRITKGDVLGAGAPAAKAAPAPAPAAAPKAAKPS
LPDVKAPASADQWLKDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMAPVMDLR
NKYKDKFEKEHGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPR
GLVVPILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPI
INPPQSAILGVHATKERAVVENGQIVIRPMNYLALSYDHRIIDGREAVLSLVAMKDALED
PARLLLDL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggctattgttgaagtcaaggttccccagctttccgagtcggtttcggaagccacgatg
ctgcagtggaagaagaagcccggcgaggctgttgctcaagacgaaattctcatcgaaatc
gagaccgacaaggtcgtactcgaagtgccggcaccctcggccggcgtgctcgcgcaagtc
atcgcgaacgacggcgacaccgtcacggcggatcaggtgatcgccaagatcgacaccgaa
ggcaccgcaagcgccgctgctgtcgaagctgaagtgaagcccgctccgcaagccgcgccg
gcgcccgccgctgcaccggctccggtggctcaagccgcatccgcaacgggtgcgaacacc
gctgcttcgccggccgccggcaagctgatggccgagaagggtctgggcgcgggcgacgtc
gccggcacgggccgcgacggccgcatcaccaagggcgacgtgctgggcgcgggcgctcct
gctgccaaggccgcaccggcaccggctccggccgccgcaccgaaggctgccaagccgtcg
ctgccggacgtcaaggcgccggcttcggctgaccaatggctgaaggaccgcccggaacaa
cgcgtgccgatgtcgcgtctgcgcgcgcgtatcgccgagcgtctgctcgagtcgcagcaa
accaacgccatcctgaccacgttcaacgaagtgaacatggcgccggtgatggacctgcgc
aacaagtacaaagacaagttcgaaaaggaacacggcgtgaagctcggcttcatgtcgttc
ttcgtgaaggcggcggttcacgcgctgaagaagttcccgctggtgaacgcgtcgatcgac
ggtaacgacatcgtctatcacggctacttcgacatcggtatcgctgtcggttcgccgcgc
ggtctggtggtgccgatcctgcgcaatgcggatcagctgagcctcgccgaaatcgaaaag
aagattgccgaattcggccagaaggcgaaagacggcaagctgtcgatcgaagaaatgacc
ggcggcacgttctcgatctcgaacggtggcgtgttcggctcgatgctgtcgaccccgatc
atcaacccgccgcaatccgccattctgggcgtgcacgccacgaaggaacgcgctgtggtc
gaaaacggccagatcgtgatccgcccgatgaactacctggcgctctcgtacgaccaccgg
atcatcgacggtcgtgaagcggtgctgtcgctggtcgccatgaaggatgcgctggaagat
ccggcgcgcctgctgctggacctgtaa

DBGET integrated database retrieval system