KEGG   Paraburkholderia aromaticivorans: CJU94_16920Help
Entry
CJU94_16920       CDS       T05169                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
parb  Paraburkholderia aromaticivorans
Pathway
parb00020  Citrate cycle (TCA cycle)
parb00310  Lysine degradation
parb00380  Tryptophan metabolism
parb01100  Metabolic pathways
parb01110  Biosynthesis of secondary metabolites
parb01120  Microbial metabolism in diverse environments
parb01130  Biosynthesis of antibiotics
parb01200  Carbon metabolism
Module
parb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
parb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:parb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CJU94_16920
  Amino acid metabolism
   00310 Lysine degradation
    CJU94_16920
   00380 Tryptophan metabolism
    CJU94_16920
Enzymes [BR:parb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     CJU94_16920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: ASV99675
UniProt: A0A248VKZ2
LinkDB All DBs
Position
1:complement(3738084..3740945)
Genome map
AA seq 953 aa AA seqDB search
MMKQFQSNSYLFGGNAPYVEEMYEAYLDNPASVPENWRSYFDALQNVPASDGSNANDVAH
GPIVESFAQRAKANAFIPRTATGGEDLATARKQVYVQSLIGAYRFLGSQWANLDPLKRRE
RPAIPELEPAFYDFTEADMDEEFSATNLYFGFERASLREIVKALRDTYCGTIGAEYMYIS
DPEQKRWWKEKLESIRSTPNFSNDKKKHILNRLTAAEGLERFLHTKYVGQKRFSLEGGES
FIASMDEVVRHGGANGVQEIVIGMAHRGRLNVLVNTLGKMPADLFAEFEGKHVDDLPAGD
VKYHKGFSSDVSTEGGPVHLSLAFNPSHLEIVNPVVEGSAKARMDRRGDDSGLQVLPVQI
HGDAAFAGQGVVMETLNLAQTRGYGTHGTLHIVINNQIGFTTSDPRDSRSTLYCSDVVKM
IEAPVLHVNGDDPEAVVLATQLAIDFRMQFHKDVVVDIVCFRKLGHNEQDTPAVTQPLMY
KTIAKHPGTRALYAEKLVQQGVITAADADEYVKAYRKAMDEGHHTVDPVLSNYKSKYAVD
WVPFLNRKWTDAADTAVPLAELKRLAERITTIPENFKVHPLVERVINDRRAMGRGEAKLD
WGMGEHLAFASLVASGYAVRLTGQDSGRGTFTHRHAVLHDQNRERWNDGTYVPLQNIAEG
QAKFTVIDSVLSEEAVLGFEYGYSTAEPNTFVAWEAQFGDFVNGAQVVIDQFISSGEVKW
GRVSGLTMLLPHGYEGQGPEHSSARIERFLQLCADHNMQVVQPTTPAQIFHLLRRQMIRL
FRKPLIVATPKSLLRHKEAVSDLSELAKGAFQPILGEIDEAIDAKKVKRVVVCSGRVYYD
LLAHRRESKSNDVAIIRIEQLYPFAHKQFEAEMKKYDNATEVVWVQDEPQNQGPWFYIEH
HLKEGMKEGQKLAYSGRPASASPAVGYYAKHYEQQKALVEGAFGRLKSASIAK
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagcaattccagtcgaactcttatctgttcggcggcaatgctccgtacgtagaa
gaaatgtacgaagcgtatctcgataatccggcgtcagtgcccgagaactggcgcagctat
ttcgacgcgttgcagaacgtccctgcatcggatggcagcaatgccaacgacgtggcccat
ggcccgatcgtcgaatcgtttgcgcaacgcgccaaggccaacgccttcatcccgcgcacc
gcaaccggcggcgaagacctcgccaccgcgcgaaagcaagtctatgtgcagtccctcatc
ggcgcatatcgcttcctcggctcgcaatgggccaacctcgatcctctgaagcgccgcgaa
cgtcccgctattcccgaactcgaacccgcgttctacgacttcaccgaagccgacatggac
gaggagttcagcgcaacgaatctgtatttcggtttcgagcgtgcttcgctgcgtgagatc
gtcaaggcgctgcgcgacacgtactgcggcacgatcggtgccgagtacatgtatatcagc
gatccggaacagaagcgctggtggaaagaaaagctcgaatcgatccgttcgacgccgaac
ttctcgaacgacaagaaaaagcacatcctgaaccgcctgacggccgctgaaggcctcgag
cgcttcctgcacaccaagtacgtcggccagaaacgcttctcgctcgaaggcggcgaaagc
ttcatcgcgtcgatggacgaagtcgtgcgtcacggcggcgccaacggcgttcaggaaatc
gtgatcggcatggctcaccgtggccgtctgaacgtgctggtcaatacgcttggcaagatg
ccggccgacctgttcgccgaattcgaaggcaagcacgtcgacgacctgccggccggcgac
gtgaagtaccacaagggcttctcgtcggacgtctcgaccgaaggcggcccggttcacctg
tcgctcgcgttcaacccgtcgcacctggaaatcgtcaacccggtggtcgaaggttcggcc
aaggcccgtatggaccgccgcggcgacgacagcggcctgcaagtgctgccggtgcagatc
cacggcgacgcggccttcgcgggccagggcgtcgtgatggaaacgctgaacctcgcgcaa
acgcgcggttacggcacgcacggcacgctgcacatcgtcatcaacaaccagatcggcttc
acgacgtcggacccgcgcgactcgcgctccacgttgtactgctcggacgtggtcaagatg
atcgaagcgccggtgctgcacgtgaacggtgacgatcctgaagcggtggttctggcgacg
cagctggcgatcgacttccgcatgcagttccacaaggacgtcgtcgtcgacatcgtctgc
ttccgcaagctgggtcacaacgagcaggacacgccggctgtcacgcagccgctgatgtac
aagaccatcgcgaagcatccgggcacgcgcgcgctgtacgctgaaaagctggtgcagcaa
ggcgtgatcacggctgccgacgccgacgaatacgtcaaggcctaccgcaaggcgatggac
gaaggtcatcacacggtcgacccggtgctctcgaactacaagagcaagtacgcggtggac
tgggtgccgttcctgaaccgcaagtggaccgacgccgcggataccgcggtgccgctcgcg
gaactgaagcgccttgctgagcgcatcaccacgattccggaaaacttcaaggttcacccg
ctggtcgagcgcgtcatcaacgaccgtcgcgcgatgggccgtggtgaagcgaagctcgac
tggggcatgggcgaacacctggcattcgcgtcgctggtcgcatcgggctacgcagttcgc
ctgaccggtcaggactcgggccgcggcacgttcacgcaccgtcacgcggtgctgcacgat
cagaaccgcgaacgctggaacgacggcacgtacgtgccgctgcagaacatcgccgagggt
caggcgaagttcacggtgatcgactcggtgctgtcggaagaagcggtgctgggcttcgaa
tacggctactcgaccgctgaaccgaatacgttcgtcgcgtgggaagcgcagttcggcgac
ttcgtgaacggcgcgcaagtcgtgatcgaccagttcatttcgtcgggcgaagtgaagtgg
ggccgtgtttcgggtctcaccatgctgctgccgcacggctacgaaggccagggtccggaa
cactcgtccgcacgtatcgagcgtttcctgcaactgtgcgcggatcacaacatgcaggtc
gttcaaccgactacgccggcgcagatcttccacctgttgcgccgccagatgatccgcctg
ttccgcaagccgctgatcgtcgccacgccgaagtcgctgctgcgccacaaggaagccgtg
tccgatctgtcggaactggcgaagggcgcgttccagccgatcctcggtgaaatcgacgaa
gccatcgacgcgaagaaggtcaagcgcgtggtcgtgtgctcgggccgcgtgtactacgac
ctgctcgcgcatcgccgtgaatcgaagtcgaacgacgtcgcgatcattcgtatcgaacag
ctctatccgttcgcgcacaagcagttcgaagcggaaatgaagaagtacgacaacgcgacc
gaagtggtctgggtgcaggacgagccgcagaatcaaggcccgtggttctacatcgagcac
cacctgaaggaaggcatgaaggaaggtcagaagctggcatacagcggacgtccggcttcg
gcctcgccggcagtcggctactacgcgaagcactacgagcagcagaaggcgctggtcgaa
ggcgctttcggccgcctcaagagcgcgtcgatcgctaaataa

DBGET integrated database retrieval system