KEGG   Paraburkholderia aromaticivorans: CJU94_23105Help
Entry
CJU94_23105       CDS       T05169                                 

Definition
(GenBank) catalase HPII
  KO
K03781  catalase [EC:1.11.1.6]
Organism
parb  Paraburkholderia aromaticivorans
Pathway
parb00380  Tryptophan metabolism
parb00630  Glyoxylate and dicarboxylate metabolism
parb01110  Biosynthesis of secondary metabolites
parb01130  Biosynthesis of antibiotics
parb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:parb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CJU94_23105
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    CJU94_23105
Enzymes [BR:parb01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     CJU94_23105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase_C Catalase-rel DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: ASW01096
UniProt: A0A248VPY3
LinkDB All DBs
Position
2:complement(755688..757811)
Genome map
AA seq 707 aa AA seqDB search
MAGKTNAQKPAAKNAQANGPESDPKSKDLEQFRVSPEGEALRTNQGVKISDNQNTLRAGP
RGPSLLEDFIMREKITHFDHERIPERIVHARGSAAHGVFQVYESMREYTKAAFLQDPAVQ
TPVYVRFSTVQGPRGSADTVRDVRGFAVKFYTQEGNYDLVGNNMPVFFIQDAIKFPDFVH
AVKPEAPNEMPTGGSAHDTFWDFVSLVPESAHMVLWTMSDRAIPRSLRTMEGFGIHTFRF
VNAQGKGRFVKFHWRPVLGSYSLLWDEAQKLAGKDPDFHRRDLWESIERGDFPEFELGVQ
IVEEADEHKFDFDLLDPTKLIPEELVPVKIIGKMTLNRNPDNFFAETEQVAFHPGHVVPG
IDFSNDPLLQGRLFSYTDTQISRLGGPNFHEIPINRPVCPFNNNQRDAMHRQTIHVGQAS
YEPNSLSGGWPKETPPAPADGGFESYQERVEGTKIRVRSESFADHFSQAALFYNSMSQPE
KDHIAAAYQFELGKVTKPEIRARVVNEILANFDAGLAAQVAEGLGLPAPKKGTAKLSGPK
ESPALSLLNRVKPGIKTRKIALLAAPGSDGAAIRKLQQTLQGEGAAPMLIAPTLAAIDGM
APDATIAGLPSIMFDAVIVVGGGEGAKTLAQSGDARHFVLEAFKHLKAIAAIGAGRDVLA
AAHLPDNADGVATGDDKQAAEVLKAFIKAAGQHRVWSRAGQAETVPA
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atggcaggtaaaacgaacgcacagaagcccgcagcgaaaaacgcgcaggcgaatggtccc
gaatcggatccgaaatcgaaggatctcgaacagtttcgagtcagtccggaaggtgaggcg
ctaagaaccaatcagggcgtcaagatctccgacaaccagaataccctgcgcgcaggtccc
cgcggcccttcgctgcttgaagatttcatcatgcgtgagaagatcacgcacttcgaccat
gagcgtattcccgagcgtatcgtgcatgcgcgcggctcggcggcgcatggcgtgtttcag
gtgtacgagtccatgcgcgagtacaccaaagccgcgtttctgcaggacccggctgtgcaa
acgccggtctatgtgcgcttttcgacggtgcaaggtccgcgcggctccgccgacacggtg
cgcgacgtgcgcggcttcgccgtgaagttctacacccaggaaggcaattacgatctggtc
ggcaacaacatgccggtgttcttcattcaggacgccatcaagtttcccgacttcgtgcat
gcggtcaaaccggaagcgccgaacgaaatgccgacgggcggatccgcgcacgacaccttc
tgggacttcgtctcgctggtgcccgaatccgcgcacatggtgctgtggaccatgtcggac
cgcgcgatcccgcgcagcctgcgcaccatggaaggcttcggcattcacacgttccgcttc
gtgaatgcccaaggcaaaggccgcttcgtcaaatttcactggcgcccggtgctgggttcg
tactcgctgctatgggatgaagcgcagaagctggccggcaaagatccggacttccatcgg
cgcgatctgtgggagtcgatcgaacgaggcgattttccggagttcgaactcggtgtgcaa
atcgttgaagaagcggatgaacacaagttcgacttcgacctgctcgatccgaccaagctg
attcccgaagaactcgtgcccgtgaagatcatcggcaagatgacgctcaatcgcaatcct
gacaatttcttcgccgaaactgaacaggtggcgtttcatccgggccatgtggtgccgggt
atcgacttctcgaacgacccgcttttgcaagggcgtttgttctcttacacggacacgcag
atcagccgcctgggcggcccgaacttccacgaaatccccatcaaccggcccgtgtgcccg
ttcaacaacaaccagcgtgacgcgatgcaccggcagacgatccatgtaggccaggcttcg
tacgagccgaattcgctgagcggcggctggccgaaggaaacccctccggcgcctgccgat
ggcggcttcgagagctatcaggagcgtgtggaaggcaccaagatccgcgtgcgcagcgaa
tcgttcgccgatcacttttcgcaggccgcgctgttttacaacagcatgtcgcagcccgaa
aaggaccatatcgccgcggcttatcagttcgaactcggcaaggtgacgaagccggagatc
cgtgcgcgcgtggtcaacgagattctcgccaacttcgatgcggggctcgcggcgcaggtg
gccgaaggactgggtttgccggcgccgaagaaaggcacggcaaagttgtccggtcccaag
gaatcgccggcgctgagtcttcttaaccgggtgaagcccggcatcaagacccgcaagatc
gccttgctggccgcccccggttcggatggcgccgccatcaggaagcttcagcagacgctg
caaggcgagggcgcggcgccgatgctgatcgccccgacgcttgccgcgatcgacggcatg
gcgccggacgcgacgatcgccggattgccgtcgatcatgttcgacgcggtgatcgtggtg
ggaggcggcgagggcgcgaagacgctggcgcaatcaggcgacgcgcggcatttcgtgctg
gaggcgttcaagcatctgaaggcgattgcggcgatcggcgcgggccgcgacgtgctcgcc
gccgcgcacttgccggacaatgccgacggcgtggcaaccggcgacgacaagcaggccgcc
gaagtgctgaaggcctttatcaaggcggctgggcagcatcgcgtgtggtcgcgtgccggg
caggccgagaccgtgccggcgtaa

DBGET integrated database retrieval system