KEGG   Paraburkholderia aromaticivorans: CJU94_32420Help
Entry
CJU94_32420       CDS       T05169                                 

Gene name
aepX
Definition
(GenBank) phosphoenolpyruvate mutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
parb  Paraburkholderia aromaticivorans
Pathway
parb00440  Phosphonate and phosphinate metabolism
parb01100  Metabolic pathways
parb01120  Microbial metabolism in diverse environments
parb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:parb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    CJU94_32420 (aepX)
Enzymes [BR:parb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     CJU94_32420 (aepX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ASW02746
UniProt: A0A248VUP2
LinkDB All DBs
Position
2:2874108..2875838
Genome map
AA seq 576 aa AA seqDB search
MNAREPAFVSASRSARLRQMLVSNELEFMMEAHNGLSARIVREAGFKAIWGSGLAISAQF
GVRDNNEASWTQVVDTLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIE
DKQFPKTNSFINGEAQPLADMDEFCGKIKAGKDSQLDEDFSIVARVEALIAGWGMDEALR
RAEAYRQAGADAILIHSKLSRPDEILEFAREWAGRAPLVIVPTKYYSTPTEVFREAGIST
VIWANHLIRAATSAMQAVAREIHASETLVNVEDSIAAVNEIFRLQDADEYSEAEDRYLSS
GRAAGSAVVLAASRGKGLEAVTEDRPKVMLPIAGKPLLRWLVDAFKKQGVNDITVVGGYR
ADAIDTAGIKLVVNERHAHTGELASLACAVDKLAGDTVVSYGDLLFRSYILRDLVESDAA
FSVVVDSSLTDAENASVRDFAWCSAADDRGLFGNKVVLRHVSSGQDATSSIASQTPHGRW
VGLLNVRGEGLERLQAVMSRLQARPDFATLDMPALLNALIEAGESIEVQYVHGHWRGVND
LEDFRRAGDFAHAQAPFAAGDTATGVAADPASGAAQ
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcccgcgaacctgctttcgtctccgcttcccgcagcgcgcgcctgcgccagatg
ctcgtcagcaacgaactcgaattcatgatggaggcccataacggcctgtccgcgcggatc
gtccgcgaagccggtttcaaggcgatctggggctcgggcctcgcgatctccgcgcaattc
ggcgtgcgcgacaacaacgaagcaagctggacgcaagtcgtcgacacgctcgaattcatg
gccgacgcgagcgacctgccgatcctcctcgacggcgataccggctacggcaatttcaac
aacgtgcgccgcctcgtgcgcaagctcgaacagcgcggcattgccggcgtgtgtatcgag
gacaagcagtttcccaagaccaacagcttcatcaacggcgaagcgcaaccgctcgccgat
atggacgagttctgcggcaagattaaagccggtaaagactcgcagctggatgaagacttt
tcgatcgtcgcgcgcgtggaagcgttgattgccggctggggtatggacgaggcgctgcgt
cgcgcggaagcgtaccgtcaagccggcgcggatgcgatcctgattcacagcaagctctcg
cgccccgacgaaattctcgagttcgcccgcgaatgggcgggccgtgctccgctcgtgatc
gtgccgaccaagtactacagcacgcccaccgaagtattccgcgaagccggcatcagcacg
gtgatctgggcgaaccatctgattcgcgcggcaacctcggccatgcaggcggtcgcgagg
gaaattcacgcgagcgaaacgctcgtcaacgtggaagacagcatcgccgccgtcaacgaa
atcttccgtctgcaagacgccgacgaatactcggaagccgaagaccgctacctgtcgagc
ggccgcgcggccggctccgcggtcgtgcttgcggcaagccgcggcaagggcctcgaagcc
gtcaccgaagaccgtccgaaagtcatgctgccgatcgccggcaagccgctgttgcgctgg
ctcgtcgatgcattcaagaagcagggcgtgaacgacatcaccgtggtcggcggttatcgc
gccgatgcgatcgacacggccggcatcaagctcgtcgtcaacgaacgccatgcgcacacc
ggcgaactcgcgtcgcttgcctgcgcggtggacaagctggcgggcgacacggtcgtctcg
tacggcgatctgctgttccgcagctatatcctgcgcgatctggtggaaagcgatgcggcg
ttcagcgtggtggtcgattcgtcgctgaccgacgcggaaaacgccagcgtgcgcgatttc
gcgtggtgctcggcggccgacgaccggggcctgttcggcaacaaggtcgtgctgcgtcac
gtatcgagcgggcaggacgcaacctcgtcgatcgcgtcgcaaacgccgcatggccgctgg
gtcggcctgctgaacgtgcgcggcgaaggccttgagcgtttgcaggcggtcatgagccgc
ttgcaggcgcgcccggatttcgcgacgctcgatatgcccgcgttgctgaacgcgctgatc
gaagcgggcgaatcgatcgaggtgcaatacgtgcacggccattggcgcggcgtgaacgac
ctcgaagacttccgccgcgcgggcgacttcgcgcatgcgcaagcgccgttcgcggccggt
gacacggcaaccggcgtggcagcggacccagcgagcggagctgcgcaatga

DBGET integrated database retrieval system