KEGG   Paraburkholderia aromaticivorans: CJU94_38015Help
Entry
CJU94_38015       CDS       T05169                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
parb  Paraburkholderia aromaticivorans
Pathway
parb00630  Glyoxylate and dicarboxylate metabolism
parb01100  Metabolic pathways
parb01110  Biosynthesis of secondary metabolites
parb01120  Microbial metabolism in diverse environments
parb01130  Biosynthesis of antibiotics
parb01200  Carbon metabolism
Module
parb_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:parb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CJU94_38015
Enzymes [BR:parb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     CJU94_38015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ASW03953
UniProt: A0A248VYK0
LinkDB All DBs
Position
pBN2:360754..361182
Genome map
AA seq 142 aa AA seqDB search
MRITQGTFSFLPDLTDEEIGLQIDYALRQGWACSIEFTDDPHPRNTYWEMWGLPMFDLHD
AAGVLQEVKACRAARPNHYIKVNAFDSTRGFETMRLSFIVNRPADEPGFRLNREEGWGRT
QRYSLTSYAGDRPAGERYGATR
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatcacacaagggacgttttccttcctgccggatctgaccgacgaagaaatcggc
ttgcagatcgactacgcgctgcgccagggctgggcgtgttcgatcgaattcaccgatgac
ccccacccgcgcaacacgtattgggagatgtggggcctgccgatgttcgacctgcacgat
gcggcaggcgtgctgcaagaggtgaaggcatgccgcgcggcacgtccgaatcactacatc
aaggtcaatgcattcgattcgacgcgcggtttcgagacgatgcgtctgtcgttcattgtc
aaccggcccgccgacgaaccgggcttccgcctcaatcgcgaggaaggatggggccgcacg
cagcgctacagcttgacgagctacgcgggcgaccggccggcaggggagcgctacggcgcg
acccgttga

DBGET integrated database retrieval system